Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
DPP9 antibody
DPP9 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purity:Min. 95%Complement factor H antibody
The Complement factor H antibody is a highly specialized antibody that plays a crucial role in the regulation of the immune system. It binds to glutamate and other molecules to prevent excessive activation of the complement system, which can lead to inflammation and tissue damage. This antibody is widely used in life sciences research, particularly in studies related to insulin, lipoprotein lipase, and heparin-induced thrombocytopenia. It is also used as a diagnostic tool for detecting insulin antibodies and as a therapeutic agent for targeting growth factors such as trastuzumab and epidermal growth factor. With its high specificity and affinity for its target molecules, this monoclonal antibody is an essential component in many medicaments and has proven to be invaluable in various research applications.
c-Jun antibody
The c-Jun antibody is a specific monoclonal antibody that targets the polymorphic protein known as c-Jun. This antibody is widely used in the field of life sciences for research purposes. It has been shown to effectively detect and bind to c-Jun, allowing for the study of its functions and interactions within cells.
Purity:Min. 95%CD45R antibody (Spectral Red)
CD45R antibody (Allophycocyanin) was raised in rat using abelson murine leukemia virus-induced pre-B tumor cells as the immunogen.
Purity:Min. 95%Molecular weight:0 g/molNorfentanyl antibody
Norfentanyl antibody is a highly specialized monoclonal antibody that is used to inhibit the activity of norfentanyl, a potent phosphatase inhibitor. This antibody specifically targets the amide group of norfentanyl and neutralizes its effects on cellular growth factors. It has been shown to effectively block the activation of tyrosine kinase receptors and prevent the binding of autoantibodies to growth hormone receptors. Norfentanyl antibody is widely used in life sciences research and has significant applications in studying cellular signaling pathways and understanding the role of growth factors in various physiological processes.RSV antibody
RSV antibody was raised in rabbit using residues 187-198 LCKSICKTIPSNKPKKKP of the RSV G protein B1 strain as the immunogen.Purity:Min. 95%CD24 antibody (biotin)
CD24 antibody (biotin) was raised in rat using murine heat stable antigen as the immunogen.
Purity:Min. 95%Molecular weight:0 g/molSHC antibody
The SHC antibody is a monoclonal antibody that acts as an inhibitor. It is widely used in the field of Life Sciences for various applications. This antibody specifically targets phosphatase, which plays a crucial role in cellular signaling pathways. By inhibiting phosphatase activity, the SHC antibody prevents the dephosphorylation of proteins involved in important cellular processes.
MCL1 antibody
The MCL1 antibody is a highly specialized monoclonal antibody that targets the phosphatase growth factor. It has been specifically designed to neutralize tyrosine and colloidal substances in the body, making it an effective tool for various medical applications. This antibody has shown promising results in inhibiting the activity of glial fibrillary acidic proteins, which are associated with neurodegenerative diseases. Additionally, it has demonstrated its efficacy in targeting and neutralizing the circumsporozoite protein, making it a potential candidate for the development of vaccines against certain infectious diseases. The MCL1 antibody is a valuable asset in the field of medical research and holds great promise for future therapeutic interventions.
BTNL8 antibody
BTNL8 antibody was raised using the N terminal of BTNL8 corresponding to a region with amino acids MALMLSLVLSLLKLGSGQWQVFGPDKPVQALVGEDAAFSCFLSPKTNAEA
Purity:Min. 95%PSENEN antibody
PSENEN antibody was raised in rabbit using the C terminal of PSENEN as the immunogen
Purity:Min. 95%AChE antibody
AChE antibody was raised in mouse using purified human cerebellar acetylcholinesterase as the immunogen.
HRP antibody
The HRP antibody is a highly sought-after product in the field of Life Sciences. It is available as both a monoclonal antibody and polyclonal antibodies. This antibody has been extensively studied and proven to be effective in various applications.Purity:Min. 95%RBM47 antibody
RBM47 antibody was raised using the middle region of RBM47 corresponding to a region with amino acids HFTSREDAVHAMNNLNGTELEGSCLEVTLAKPVDKEQYSRYQKAARGGGA
RARG antibody
The RARG antibody is a monoclonal antibody that targets the retinoic acid receptor gamma (RARG). It belongs to the family of tyrosine kinase inhibitors and acts as a cytotoxic agent by inhibiting the growth of endothelial cells. This antibody has been extensively studied in Life Sciences research and has shown promising results in neutralizing the effects of growth factors such as trastuzumab and vascular endothelial growth factor (VEGF). Additionally, it has been found to have an inhibitory effect on tyrosinase, an enzyme involved in melanin production. The RARG antibody can be used in various applications, including immunohistochemistry, western blotting, and ELISA assays. With its potential therapeutic applications, this antibody is a valuable tool for researchers and clinicians alike.
Complement C1q antibody
Complement C1q antibody was raised in mouse using human complement C1q as the immunogen.
PDE3B antibody
PDE3B antibody was raised using the middle region of PDE3B corresponding to a region with amino acids SRPEYNFLLHLDHVEFKRFRFLVIEAILATDLKKHFDFLAEFNAKANDVNPurity:Min. 95%SSR3 antibody
The SSR3 antibody is a monoclonal antibody that is used in Life Sciences research. It specifically targets the nuclear receptor GLP-1 and has been widely used in various assays and experiments. The SSR3 antibody is highly specific and exhibits high affinity for its target, making it an ideal tool for studying the functions of GLP-1. This antibody has been successfully used in experiments involving electrode-based techniques, such as patch-clamp recordings, as well as in immunoassays to detect GLP-1 levels in human serum samples. Additionally, the SSR3 antibody has shown efficacy in cytotoxicity assays and has been used to study the effects of GLP-1 on cell growth and survival. Its versatility and reliability make it a valuable tool for researchers working in the field of Life Sciences.
CD38 antibody
CD38 antibody was raised in Mouse using a purified recombinant fragment of human CD38 expressed in E. coli as the immunogen.
HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productCA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
