Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
SLC22A16 antibody
SLC22A16 antibody was raised using a synthetic peptide corresponding to a region with amino acids CSRNKRENTSSLGYEYTGSKKEFPCVDGYIYDQNTWKSTAVTQWNLVCDR
RPL9 antibody
RPL9 antibody was raised using the C terminal of RPL9 corresponding to a region with amino acids ELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTVQQADE
TPI1 antibody
TPI1 antibody was raised using the N terminal of TPI1 corresponding to a region with amino acids MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYID
Human Growth Hormone antibody
Human growth hormone antibody was raised in mouse using recombinant human growth hormone as the immunogen.
Septin 10 antibody
Septin 10 antibody was raised using the C terminal of 40431 corresponding to a region with amino acids ERMKLEEKRRLLEEEIIAFSKKKATSEIFHSQSFLATGSNLRKDKDRKNS
MC5R antibody
The MC5R antibody is a highly specialized monoclonal antibody that binds to the MC5 receptor, a specific type of receptor found in various cells throughout the body. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications.
ERK1/2 antibody
ERK 1/2 antibody was raised in Mouse using a purified recombinant fragment of human MAPK1 expressed in E. coli as the immunogen.CPLA2 antibody
The CPLA2 antibody is a monoclonal antibody that specifically targets cytosolic phospholipase A2 (cPLA2). cPLA2 is an enzyme that plays a crucial role in the release of arachidonic acid, which is a precursor for the synthesis of various bioactive lipid mediators. This antibody has been extensively used in research to study the role of cPLA2 in various cellular processes, including inflammation, cell growth, and neuroprotection. It has also been used to investigate the interactions between cPLA2 and other molecules such as growth factors and neurotrophic factors. The CPLA2 antibody is highly reactive and provides reliable results in experiments involving techniques like immunohistochemistry, Western blotting, and ELISA. Whether you are studying the effects of cPLA2 on glial fibrillary acidic protein or investigating its potential as a therapeutic target, this antibody will be an invaluable tool in your research.
PVRL2 antibody
The PVRL2 antibody is a highly specialized antibody that targets the PVRL2 protein. This protein plays a crucial role in various biological processes, including cell adhesion, immune response, and signal transduction. The PVRL2 antibody has been extensively studied and proven to be effective in research applications related to echinococcus, tyrosine kinase-like activity, phosphatase activity, arginase activity, actin filament organization, and circumsporozoite protein interactions.
STUB1 antibody
STUB1 antibody was raised using the N terminal of STUB1 corresponding to a region with amino acids MKGKEEKEGGARLGAGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYG
Apof antibody
Apof antibody was raised in rabbit using the C terminal of Apof as the immunogenPurity:Min. 95%SMAD4 antibody
The SMAD4 antibody is a highly effective inhibitor that targets the histidine-rich region of the human serum. It specifically blocks the activity of growth factors, preventing their binding to receptors and subsequent signaling pathways. This monoclonal antibody has been extensively studied and proven to be nephrotoxic in various experimental models. Additionally, it has shown promising results in inhibiting the epidermal growth factor pathway, making it a potential therapeutic option for diseases associated with its overactivation.
GLIS3 antibody
GLIS3 antibody was raised in rabbit using the N terminal of GLIS3 as the immunogenPurity:Min. 95%RAB32 antibody
The RAB32 antibody is a monoclonal antibody that targets the RAB32 protein. This protein plays a crucial role in various cellular processes, including the regulation of superoxide production and growth factor signaling. The RAB32 antibody has been shown to effectively neutralize the activity of RAB32, making it a valuable tool for researchers in the field of Life Sciences.
FAM13C1 antibody
FAM13C1 antibody was raised using the N terminal of FAM13C1 corresponding to a region with amino acids TEHVVSSQSECQVRAGTPAHESPQNNAFKCQETVRLQPRIDQRTAISPKD
CACNB4 antibody
CACNB4 antibody was raised using the C terminal of CACNB4 corresponding to a region with amino acids LEAYWRATHTTSSTPMTPLLGRNLGSTALSPYPTAISGLQSQRMRHSNHS
ACTN2 antibody
ACTN2 antibody was raised in rabbit using the C terminal of ACTN2 as the immunogenPurity:Min. 95%Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productHBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
