Primary Antibodies

<p>SIP1 antibody was raised using the middle region of SIP1 corresponding to a region with amino acids HSLIRQLARRCSEVRLLVDSKDDERVPALNLLICLVSRYFDQRDLADEPS</p>

<p>Rat monoclonal CD23 antibody (biotin)</p>

<p>Mouse monoclonal Xa21 antibody</p>

<p>Mouse monoclonal NEFL antibody</p>

<p>The DGKA antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It has shown promising results in antiestrogen therapy and has been found to effectively target specific antigens. Additionally, this antibody has demonstrated the ability to regulate natriuretic levels and reduce viscosity in human serum.</p>

<p>DO-11.10 T cell Receptor Monoclonal Antibody (FITC)</p>

<p>Rat monoclonal CD147 antibody (PE)</p>

<p>Mouse monoclonal EPHX2 antibody</p>

<p>Rabbit polyclonal ISG15 antibody (biotin)</p>

<p>Rabbit polyclonal DNAI2 antibody</p>

<p>Rabbit polyclonal CYP4Z1 antibody</p>

<p>IFN gamma antibody was raised in mouse using human interferon beta as the immunogen.</p>

<p>Rabbit polyclonal RRAGB antibody</p>

<p>MCM4 antibody was raised using the N terminal of MCM4 corresponding to a region with amino acids SRVEGTPRSGVRGTPVRQRPDLGSAQKGLQVDLQSDGAAAEDIVASEQSL</p>

<p>Rabbit Polyclonal 4EBP1 antibody</p>

<p>BLM Monoclonal Antibody (FITC)</p>

<p>LACRT antibody was raised in Rabbit using Human LACRT as the immunogen</p>

<p>HSPA2 antibody was raised in Rabbit using Human HSPA2 as the immunogen</p>

<p>CC2D1A antibody was raised in Rabbit using Human CC2D1A as the immunogen</p>

<p>The GIRK1 antibody is a polyclonal antibody used in the field of Life Sciences. It specifically targets the GIRK1 protein, which plays a crucial role in various biological processes. This antibody can be used for research purposes to study the function and regulation of GIRK1.</p>

<p>RBM38 antibody was raised using the middle region of RBM38 corresponding to a region with amino acids QYPYAASPATAASFVGYSYPAAVPQALSAAAPAGTTFVQYQAPQLQPDRM</p>

<p>PEX26 antibody was raised using the N terminal of PEX26 corresponding to a region with amino acids MKSDSSTSAAPLRGLGGPLRSSEPVRAVPARAPAVDLLEEAADLLVVHLD</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. With its bactericidal activity, it effectively treats tuberculosis infections by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase. This prevents transcription and replication, leading to the elimination of the infection. The active compounds in this drug have been extensively studied using advanced techniques like patch-clamp and transcription-quantitative polymerase chain. Metabolized through various transformations, including hydrolysis, oxidation, reduction, and conjugation, it specifically targets Mycobacterium tuberculosis strains and inhibits their growth. Experience the potent action of 6-Fluoro-3-indoxyl-beta-D-galactopyranoside for effective tuberculosis treatment.</p>

<p>The OLIG2 antibody is a monoclonal antibody that specifically targets the TGF-beta protein. It has been extensively tested and proven to effectively neutralize the activity of TGF-beta in human serum. This antibody is widely used in Life Sciences research for various applications, including immunohistochemistry, western blotting, and flow cytometry.</p>

<p>Rabbit polyclonal PYGB antibody (biotin)</p>

<p>Rabbit polyclonal RNF212 antibody</p>

<p>HGS antibody is a polyclonal antibody that specifically targets endosomes. This antibody is used in various applications, including immunological research and therapeutic purposes. It has been shown to have an inhibiting effect on the antigen-presenting function of endosomes, making it a valuable tool for studying immunomodulation. Additionally, HGS antibody has demonstrated antinociceptive properties, suggesting its potential use in pain management. With its wide range of applications and proven effectiveness, HGS antibody is a crucial component in the field of Life Sciences.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, ultimately inhibiting bacterial growth. Rigorous testing using the patch-clamp technique on human erythrocytes has revealed its high efficacy in combating tuberculosis. Additionally, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Notably, it also exhibits specific binding to markers expressed at high levels in Mycobacterium tuberculosis strains and effectively inhibits cell growth in culture.</p>

<p>The Catalase antibody is a powerful tool used in various research applications. It is available in both polyclonal and monoclonal forms, providing researchers with options based on their specific needs. This antibody is highly specific and has been extensively validated for use in immunoassays.</p>

<p>ApoBEC3D antibody was raised using a synthetic peptide corresponding to a region with amino acids SYTWLCYEVKIKRGRSNLLWDTGVFRGPVLPKRQSNHRQEVYFRFENHAE</p>

<p>AMD1 antibody was raised using the N terminal of AMD1 corresponding to a region with amino acids MGRMNSDCWYLYTLDFPESRVISQPDQTLEILMSELDPAVMDQFYMKDGV</p>

<p>KIF20A antibody was raised in Rabbit using Human KIF20A as the immunogen</p>

<p>Rabbit polyclonal WFDC2 antibody (biotin)</p>

<p>MATR3 antibody was raised in Rabbit using Human MATR3 as the immunogen</p>

<p>H1F0 antibody was raised in Rabbit using Human H1F0 as the immunogen</p>

<p>CAST antibody was raised in Rabbit using Human CAST as the immunogen</p>

<p>Mouse monoclonal RTN4IP1 antibody</p>

<p>Rabbit polyclonal BCKD antibody</p>

<p>Mouse monoclonal NUDT18 antibody</p>

<p>Mouse monoclonal GPHN antibody</p>

<p>IFIT3 antibody was raised using the N terminal of IFIT3 corresponding to a region with amino acids ATMYNLLAYIKHLDGNNEAALECLRQAEELIQQEHADQAEIRSLVTWGNY</p>

<p>NFS1 antibody was raised in mouse using recombinant Human Nfs1 Nitrogen Fixation 1 Homolog (S. Cerevisiae)</p>

<p>Rabbit polyclonal MRPL11 antibody</p>

<p>Rabbit polyclonal CISD1 antibody</p>

<p>The CD13 antibody is a monoclonal antibody that targets CD13, a cell surface protein involved in various biological processes. This antibody is widely used in research and diagnostics in the field of Life Sciences. It can be used for applications such as immunohistochemistry, flow cytometry, and western blotting.</p>

<p>C1D antibody was raised in Rabbit using Human C1D as the immunogen</p>

<p>The RAB32 antibody is a monoclonal antibody that targets the RAB32 protein. This protein plays a crucial role in various cellular processes, including the regulation of superoxide production and growth factor signaling. The RAB32 antibody has been shown to effectively neutralize the activity of RAB32, making it a valuable tool for researchers in the field of Life Sciences.</p>

<p>LACTB2 antibody was raised in Rabbit using Human LACTB2 as the immunogen</p>

<p>ISYNA1 antibody was raised using the N terminal of ISYNA1 corresponding to a region with amino acids LQEQLWPHMEALRPRPSVYIPEFIAANQSARADNLIPGSRAQQLEQIRRD</p>

<p>The CD90.2 antibody is a monoclonal antibody that specifically targets and binds to CD90.2, a cell surface protein also known as Thy1. It has been shown to be effective in blocking the activity of tumor necrosis factor-alpha (TNF-α) and interleukin-6 (IL-6), two pro-inflammatory cytokines involved in various diseases and immune responses.</p>

<p>Purified Polyclonal PAX9 antibody</p>

<p>SDSL antibody was raised using the middle region of SDSL corresponding to a region with amino acids ALAAIYSGLLRRLQAEGCLPPSLTSVVVIVCGGNNINSRELQALKTHLGQ</p>

<p>KHDRBS3 antibody was raised using the C terminal of KHDRBS3 corresponding to a region with amino acids EQSYDSYDNSYSTPAQSGADYYDYGHGLSEETYDSYGQEEWTNSRHKAPS</p>

<p>The Flag Tag antibody is a highly specialized monoclonal antibody that is commonly used in Life Sciences research. It is designed to specifically bind to the Flag epitope, a small peptide sequence that is commonly fused to recombinant proteins for detection and purification purposes. This antibody has been extensively validated and optimized for various applications, including immunoblotting, immunoprecipitation, immunocytochemistry, and flow cytometry. Its high specificity and sensitivity make it an essential tool for researchers studying protein expression and localization. The Flag Tag antibody has been successfully used in a wide range of experimental techniques. For example, it has been employed in electrospinning studies to investigate the growth factors released from nanofibrous scaffolds. Additionally, it has been utilized in electrochemical impedance spectroscopy experiments to detect imatinib, a tyrosine kinase receptor inhibitor. Furthermore, this antibody has proven valuable in the field of oncolytic adenovirus research. It has been used to analyze the reactive</p>

<p>Purified Polyclonal FHL3 antibody</p>

<p>Cyclin D3 antibody was raised in mouse using human recombinant cyclin D3 protein as the immunogen.</p>

<p>Rabbit anti-canine IgG (H + L) (FITC) was raised in rabbit using canine IgG (H &amp; L) as the immunogen.</p>

<p>Mouse monoclonal SulT2A1 antibody</p>

<p>Calmodulin antibody was raised in mouse using calmodulin purified from Dictyostelium discoideum as the immunogen.</p>

<p>The FABP3 antibody is a highly specialized monoclonal antibody that plays a crucial role in various biological processes. It acts as a growth factor and is involved in the immobilization of biomolecules. This antibody specifically targets FABP3, also known as alpha-fetoprotein, which is found in human serum. By binding to FABP3, this antibody exhibits cytotoxic effects, making it a valuable tool in research and diagnostics within the Life Sciences field. Its unique composition and histidine amide structure allow for precise targeting and efficient detection of FABP3. Whether you're conducting experiments or developing new therapies, the FABP3 antibody is an essential component for your scientific endeavors.</p>

<p>FBXO24 antibody was raised using the N terminal of FBXO24 corresponding to a region with amino acids MGEKAVPLLRRRRVKRSCPSCGSELGVEEKRGKGNPISIQLFPPELVEHI</p>

<p>Rabbit polyclonal Eif4g antibody (Ser1108)</p>

<p>Mouse monoclonal KIAA1609 antibody</p>

<p>Mouse monoclonal NEUROG1 antibody</p>

<p>Rabbit polyclonal RCAN1 antibody</p>

<p>The RCC1 antibody is a crucial tool in the field of Life Sciences. It is an autoantibody that specifically targets RCC1, a nuclear protein involved in cell cycle regulation. This antibody is widely used as a research tool to study the function and localization of RCC1 in various cellular processes. The RCC1 antibody is available as both polyclonal and monoclonal antibodies, allowing researchers to choose the most suitable option for their experiments. It has been extensively validated for its specificity and sensitivity, making it a reliable tool for detecting and quantifying RCC1 levels in different samples. Whether you are studying cell division, chromatin organization, or other related processes, the RCC1 antibody is an essential component of your research toolkit.</p>

<p>Purified Polyclonal Serpin A1 antibody</p>

<p>Mouse brain antibody (FITC) was raised in rabbit using brain tissue from C3H mice as the immunogen.</p>

<p>The GPR158 antibody is a monoclonal antibody that specifically targets GPR158, a cationic receptor involved in various biological processes. This antibody has been extensively tested and validated for its specificity and effectiveness in scientific research. It can be used in a wide range of applications, including immunohistochemistry, Western blotting, and ELISA.</p>

<p>LCK antibody was raised in Rabbit using Human LCK as the immunogen</p>

<p>LTBR antibody was raised in Rabbit using Human LTBR as the immunogen</p>

<p>Rabbit polyclonal AP4E1 antibody</p>

<p>Rabbit polyclonal SLC20A1 antibody</p>

<p>IFT81 antibody was raised in Rabbit using Human IFT81 as the immunogen</p>

<p>Rabbit polyclonal RPS21 antibody</p>

<p>IWS1 antibody was raised in Rabbit using Human IWS1 as the immunogen</p>

<p>The CLIC6 antibody is a highly specific monoclonal antibody that targets β-catenin, a key protein involved in various cellular processes. This antibody has been developed using cutting-edge technology and has shown exceptional binding affinity and specificity for β-catenin. It is derived from Gynura procumbens, a plant known for its medicinal properties.</p>

<p>Mouse monoclonal KIAA0495 antibody</p>

<p>Rabbit polyclonal TRIM6 antibody</p>

<p>Mouse monoclonal PDE1B antibody</p>

<p>The PER2 antibody is a highly versatile and effective tool in the field of life sciences. It belongs to the class of polyclonal antibodies and monoclonal antibodies, making it suitable for a wide range of applications. This antibody specifically targets the PER2 protein, which plays a crucial role in regulating circadian rhythms and biological processes.</p>

<p>The APP antibody is a monoclonal antibody that specifically targets amyloid precursor protein (APP). This protein plays a crucial role in the development of Alzheimer's disease. The APP antibody has been extensively studied in the field of life sciences and has shown promising results in various research applications.</p>

<p>H3F3B antibody was raised in Rabbit using Human H3F3B as the immunogen</p>

<p>Rabbit polyclonal EIF4A2 antibody (biotin)</p>

<p>KIF20B antibody is a highly specific monoclonal antibody that targets the KIF20B protein. This protein is involved in various cellular processes, including cell division and intracellular transport. The KIF20B antibody can be used for research purposes to study the function and localization of this protein in different cell types.</p>

<p>Mouse monoclonal NHEJ1 antibody</p>

<p>The MMP1 antibody is a highly effective drug antibody that targets matrix metalloproteinase-1 (MMP-1). It works by inhibiting the activity of MMP-1, an enzyme involved in tissue remodeling and degradation. This antibody has been extensively studied and shown to have potent inhibitory effects on MMP-1 activity.</p>

<p>Rabbit polyclonal RuBisCO antibody (HRP)</p>

<p>RNASEH1 antibody was raised using the middle region of RNASEH1 corresponding to a region with amino acids EVINKEDFVALERLTQGMDIQWMHVPGHSGFIGNEEADRLAREGAKQSED</p>

<p>Rabbit polyclonal RCL antibody</p>

<p>The FHL1 antibody is a highly specialized product in the field of Life Sciences. It is designed to target and neutralize antiphospholipid antibodies found in human serum. These antibodies are known to cause various autoimmune disorders and can lead to serious health complications. The FHL1 antibody acts as an inhibitory factor, preventing the harmful effects of these antibodies on the body.</p>

<p>CCT8 antibody was raised using a synthetic peptide corresponding to a region with amino acids DMLEAGILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGGPKPPSGKK</p>

<p>Rabbit polyclonal RAB35 antibody</p>

<p>Rabbit polyclonal SLC11A2 antibody</p>

<p>Phencyclidine antibody was raised in mouse using phenocyclidine-BSA as the immunogen.</p>

<p>Rabbit polyclonal RHOBTB3 antibody</p>

<p>Rat monoclonal IgD antibody (biotin)</p>

<p>Mouse monoclonal JEV ED3 antibody</p>

<p>The Smoothelin antibody is a highly specific antibody that targets smoothelin, a protein found in smooth muscle cells. It has been extensively tested and validated for use in various applications, including immunohistochemistry, western blotting, and flow cytometry. This antibody is produced using state-of-the-art techniques, ensuring high affinity and specificity. It can be used to study the role of smoothelin in various physiological and pathological processes, such as smooth muscle contraction, cardiovascular diseases, and cancer. The Smoothelin antibody is an essential tool for researchers in the field of life sciences who are interested in understanding the function of smooth muscle cells and developing potential therapeutic interventions.</p>

<p>MCM7 antibody was raised using the middle region of MCM7 corresponding to a region with amino acids HRIVKMNKSEDDESGAGELTREELRQIAEEDFYEKLAASIAPEIYGHEDV</p>