Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75448 products of "Primary Antibodies"
ATXN3 antibody
The ATXN3 antibody is a highly specific monoclonal antibody that targets the ATXN3 antigen. It is commonly used in research and diagnostic applications to detect the presence of autoantibodies against ATXN3. This antibody has been extensively validated for use in immunohistochemistry experiments, allowing researchers to study the distribution and localization of ATXN3 in various tissues and cell types.
RAP1GDS1 antibody
The RAP1GDS1 antibody is a monoclonal antibody that specifically targets annexin A2. It is widely used in Life Sciences research for various applications, including immunohistochemistry, Western blotting, and flow cytometry. Annexin A2 plays a crucial role in cell signaling pathways, particularly those involving epidermal growth factor (EGF), low-density lipoprotein (LDL) receptor-related protein 1 (LRP1), basic protein (BP), collagen, endothelial growth factor (EGF), and transforming growth factor-beta (TGF-beta). This antibody allows researchers to study the expression and localization of annexin A2 in different cell types and tissues. With its high specificity and sensitivity, the RAP1GDS1 antibody is an invaluable tool for understanding the functions of annexin A2 in cellular processes and disease mechanisms.
CDC42 antibody
The CDC42 antibody is a highly specialized antibody that targets the protein CDC42. This protein plays a crucial role in various cellular processes, including cell growth, division, and movement. The CDC42 antibody is designed to bind specifically to CDC42, thereby neutralizing its activity.
COL3A1 antibody
The COL3A1 antibody is a polyclonal antibody that is widely used in Life Sciences research. It specifically targets the COL3A1 gene, which encodes for the collagen type III alpha 1 chain protein. This protein is predominantly found in cardiomyocytes and plays a crucial role in maintaining the structural integrity of the heart. The COL3A1 antibody has been extensively tested and validated for its specificity and sensitivity. It has shown excellent performance in various applications, including Western blotting, immunohistochemistry, and ELISA assays. In addition to its high affinity for the target protein, this antibody also exhibits minimal cross-reactivity with other proteins commonly found in human serum or albumin. This ensures accurate and reliable results in experiments involving complex biological samples. Researchers have also reported successful use of the COL3A1 antibody in combination with other antibodies, such as anti-CD20 antibodies or protein kinase inhibitors. This allows for more comprehensive studies on signaling pathways or cellular interactions involving COL3
Goat anti Human IgM (HRP)
Goat anti-human IgM (HRP) was raised in goat using human IgM mu heavy chain as the immunogen.
Purity:Min. 95%CD203c antibody
CD203c antibody is a highly specialized antibody used in the field of Life Sciences. It is designed to target and bind to DNA binding proteins that play a crucial role in various cellular processes. This antibody has been extensively studied and proven to be effective in glycosylation studies, where it helps researchers understand the role of glycosylation in protein function and regulation.
IFI44L antibody
IFI44L antibody was raised using the N terminal of IFI44L corresponding to a region with amino acids MEVTTRLTWNDENHLRKLLGNVSLSLLYKSSVHGGSIEDMVERCSRQGCT
IL6 antibody
IL6 antibody is a monoclonal antibody that specifically targets interleukin-6 (IL-6), a pro-inflammatory cytokine involved in various immune responses. IL-6 plays a crucial role in inflammation, autoimmune disorders, and cancer progression. The IL6 antibody binds to IL-6, neutralizing its activity and preventing it from binding to its receptors.
GSTO1 antibody
The GSTO1 antibody is a highly specialized antibody that targets specific proteins and molecules in the body. It has been extensively studied for its ability to interact with various substances, including anti-ACTH antibodies, adiponectin, annexin, and adiponectin receptor. The GSTO1 antibody has also been found to inhibit the activity of family kinase inhibitors and fibrinogen.
STK39 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds in Mycobacterium tuberculosis strains. This bactericidal drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its effectiveness has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. Metabolized through various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation with glucuronic acid, this drug shows remarkable potential in treating tuberculosis infections.
Rabbit anti Bovine IgG (H + L) (Texas Red)
Rabbit anti-bovine IgG (H+L) was raised in rabbit using bovine IgG whole molecule as the immunogen.
Purity:Min. 95%MTUS1 antibody
MTUS1 antibody was raised using the N terminal of MTUS1 corresponding to a region with amino acids QLLACGNTKFEALTVVIQHLLSEREEALKQHKTLSQELVNLRGELVTAST
SH1 antibody
The SH1 antibody is a polyclonal antibody that has been developed as a potential biological tool for studying tumor biomarkers. It specifically targets the IL-17A antigen, which is known to be involved in various protein-protein interactions and signaling pathways. The SH1 antibody can be used in various life science applications, including immunohistochemistry, western blotting, and ELISA assays. It has been shown to exhibit strong inhibition effects on IL-17A activity in vitro and in vivo. The SH1 antibody is produced using a eukaryotic expression vector and synthetic techniques, ensuring high purity and specificity. With its unique characteristics and versatility, the SH1 antibody is an essential tool for researchers investigating IL-17A-related pathways and exploring potential therapeutic interventions.
IpaD antibody
The IpaD antibody is a glycoprotein that has denaturing properties. It is known for its neuroprotective and neutralizing effects. This high polymer glycan has been found to interact with hormone peptides and collagens. The IpaD antibody is produced through the use of monoclonal antibodies, which are created through recombinant techniques. Its glycosylation plays a crucial role in its functionality. It should be noted that this antibody may have teratogenic effects and caution should be exercised when using it. The IpaD antibody is commonly used in research and diagnostic applications due to its specificity and affinity for its target antigen.MHC class II antibody
The MHC class II antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody specifically targets the antigen binding domain of MHC class II molecules, which play a crucial role in immune response regulation. By binding to these molecules, the antibody can modulate their activity and impact various biological processes.
ERH antibody
The ERH antibody is a monoclonal antibody that targets the ERH protein. This protein is involved in various cellular processes, including insulin signaling and glutamate metabolism. The ERH antibody specifically recognizes the amino group of the ERH protein and can be used in various applications, such as Western blotting and immunohistochemistry.
ELAVL4 antibody
ELAVL4 antibody was raised using the N terminal of ELAVL4 corresponding to a region with amino acids MQTGATTDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITG
LRRC24 antibody
LRRC24 antibody was raised using the N terminal of LRRC24 corresponding to a region with amino acids HLPRLQELHLQENSIELLEDQALAGLSSLALLDLSRNQLGTISREALQPL
Purity:Min. 95%Fractalkine antibody
The Fractalkine antibody is a powerful anticoagulant that belongs to the class of monoclonal antibodies. It works by targeting and neutralizing the virus surface antigen, preventing its ability to cause harm. This antibody has been extensively studied and characterized using mass spectrometric methods, ensuring its high quality and effectiveness. In addition to its anticoagulant properties, the Fractalkine antibody also acts as a chemokine, attracting immune cells to the site of infection and promoting an effective immune response. It has been shown to activate 3-kinase signaling pathways and enhance interferon production. The Fractalkine antibody is available in both polyclonal and monoclonal forms, providing options for different research needs. With its exceptional performance and reliability, this antibody is a valuable tool in Life Sciences research.
POSTN antibody
The POSTN antibody is an inhibitory factor that belongs to the group of polyclonal antibodies. It is specifically designed to target and neutralize the activity of POSTN, a protein expressed in cardiomyocytes. This antibody is widely used in life sciences research and has been shown to effectively inhibit the function of autoantibodies against POSTN. The POSTN antibody is available in both polyclonal and monoclonal forms, allowing researchers to choose the most suitable option for their experiments. Its high affinity and specificity make it an ideal tool for studying the role of POSTN in various biological processes, such as cell signaling, inflammation, and tissue remodeling. The amino-terminal region of the POSTN protein is particularly targeted by this antibody, ensuring accurate and reliable results. Order your POSTN antibody today and unlock new insights into its function and therapeutic potential.
Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productCA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
