Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
RORA antibody
RORA antibody was raised using the N terminal of RORA corresponding to a region with amino acids TPTPAGEGARRDELFGILQILHQCILSSGDAFVLTGVCCSWRQNGKPPYS
CLIC4 antibody
CLIC4 antibody was raised using the N terminal of CLIC4 corresponding to a region with amino acids LSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVF
PSPH antibody
The PSPH antibody is a monoclonal antibody produced by a hybridoma cell strain. It is designed to specifically target and bind to the PSPH protein, which plays a crucial role in various biological processes. The antibody can be used in life sciences research, diagnostic assays, and therapeutic applications.
ENOPH1 antibody
ENOPH1 antibody was raised using the N terminal of ENOPH1 corresponding to a region with amino acids IEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASGNGVD
RARG antibody
The RARG antibody is a monoclonal antibody that targets the retinoic acid receptor gamma (RARG). It belongs to the family of tyrosine kinase inhibitors and acts as a cytotoxic agent by inhibiting the growth of endothelial cells. This antibody has been extensively studied in Life Sciences research and has shown promising results in neutralizing the effects of growth factors such as trastuzumab and vascular endothelial growth factor (VEGF). Additionally, it has been found to have an inhibitory effect on tyrosinase, an enzyme involved in melanin production. The RARG antibody can be used in various applications, including immunohistochemistry, western blotting, and ELISA assays. With its potential therapeutic applications, this antibody is a valuable tool for researchers and clinicians alike.
Complement C1q antibody
Complement C1q antibody was raised in mouse using human complement C1q as the immunogen.
EXOC6 antibody
EXOC6 antibody was raised using the middle region of EXOC6 corresponding to a region with amino acids YRCLHIYSVLGDEETFENYYRKQRKKQARLVLQPQSNMHETVDGYRRYFT
Factor VIII antibody (biotin)
Factor VIII antibody (biotin) was raised in sheep using human Factor VIII purified from concentrate as the immunogen.Calretinin antibody
The Calretinin antibody is a highly specialized monoclonal antibody that is used in the field of Life Sciences. It is designed to target and detect the presence of calretinin, a calcium-binding protein found in various tissues and cells. This antibody has been extensively tested and validated for its specificity and sensitivity.
GHR antibody
The GHR antibody is a highly specialized monoclonal antibody that targets the hydrogen atom in natural compounds. It is designed to specifically bind to the dpp4 enzyme, inhibiting its activity and preventing the breakdown of certain hormones. This antibody is commonly used in life sciences research to study the role of dpp4 in various biological processes, including adipose tissue metabolism and hepatocyte growth. Additionally, this antibody can be utilized as a selectable marker in polymerase chain reaction (PCR) experiments or interferon assays. With its high affinity and specificity, the GHR antibody is an invaluable tool for scientists and researchers in the field of molecular biology.
ApoH antibody (HRP)
ApoH antibody (HRP) was raised in goat using human Beta-2-Glycoprotein purified from plasma as the immunogen.
HNRPL antibody
HNRPL antibody was raised using the N terminal of HNRPL corresponding to a region with amino acids DTWDYTNPNLSGQGDPGSNPNKRQRQPPLLGDHPAEYGGPHGGYHSHYHD
RABGEF1 antibody
RABGEF1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSLKSERRGIHVDQSDLLCKKGCGYYGNPAWQGFCSKCWREEYHKARQKQ
KCNK3 antibody
KCNK3 antibody was raised using the C terminal of KCNK3 corresponding to a region with amino acids TCVEQSHSSPGGGGRYSDTPSRRCLCSGAPRSAISSVSTGLHSLSTFRGL
Mouse anti Rat IgG2a (HRP)
IgG2a antibody was raised in Mouse using Rat IgG2a as the immunogen.Purity:Min. 95%Fibrinogen antibody
The Fibrinogen antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to specifically target and bind to fibrinogen, a glycoprotein involved in blood clot formation. This antibody has been extensively studied and has shown great potential in various research applications.
DHEA antibody
The DHEA antibody is a polyclonal antibody that is used for the quantitation and detection of dehydroepiandrosterone (DHEA) in various biological samples. The DHEA antibody was raised in sheep using DHEA(17)-BTG as the immunogen. Supplied at 10mg/ml, a matched pair conjugate is available for DHEA antibody: 80-1055Purity:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productCA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
