Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
PIAS4 antibody
The PIAS4 antibody is a highly specialized polyclonal antibody used in Life Sciences research. This antibody specifically targets the protein known as PIAS4, which stands for Protein Inhibitor of Activated STAT 4. PIAS4 is involved in various cellular processes, including epidermal growth factor signaling and interferon response.
SDHB antibody
The SDHB antibody is a highly specialized antibody that is used in various immunoassays and life science research. It is available as both monoclonal and polyclonal antibodies, offering a wide range of applications. This antibody specifically targets the SDHB protein, which plays a crucial role in cellular respiration and energy production.
VAV1 antibody
The VAV1 antibody is a highly specialized polyclonal antibody that targets the VAV1 protein. This protein plays a crucial role in endothelial growth and has been implicated in various biological processes. The VAV1 antibody is available as both polyclonal and monoclonal antibodies, allowing for versatile applications in life sciences research.
Transferrin antibody
Transferrin antibody was raised in rabbit using rat transferrin as the immunogen.
Purity:Min. 95%SLAMF7 antibody
The SLAMF7 antibody is a highly specialized biomolecule that acts as a growth factor and protein kinase. It is commonly used in Life Sciences research and has proven to be an invaluable tool for scientists in various fields. This monoclonal antibody specifically targets the interleukin-15 receptor, which plays a crucial role in immune response regulation.
GATA4 antibody
The GATA4 antibody is a highly specific monoclonal antibody that is used in various applications within the field of Life Sciences. This cytotoxic antibody is designed to target and bind to GATA4, a transcription factor that plays a crucial role in the regulation of gene expression. By binding to GATA4, this antibody can modulate its activity and potentially inhibit its function.
Rabbit Kappa light chain antibody (Prediluted for IHC)
Rabbit polyclonal Kappa light chain antibody (Prediluted for IHC)Purity:Min. 95%PPM1G antibody
The PPM1G antibody is a highly effective medicament that has been extensively studied in various scientific fields, including hybridization and human hepatocytes. This antibody specifically targets pancreatic elastase, an enzyme involved in the breakdown of proteins in the pancreas. By inhibiting the activity of pancreatic elastase, this antibody can prevent cytotoxic effects and promote overall health.
AML1 antibody
The AML1 antibody is a highly specialized Polyclonal Antibody used in immunosuppressant therapies. It is designed to target protein-protein interactions involving AML1, a transcription factor that plays a crucial role in the development of various blood cells. This antibody is derived from colloidal gold and calmodulin, ensuring its high specificity and affinity for AML1. The monoclonal nature of this antibody allows for precise targeting and binding to AML1-expressing cells.
TFE3 antibody
TFE3 antibody is a highly specific antibody that targets the TFE3 protein, which is involved in regulating gene expression. This antibody can be used in various applications such as immunohistochemistry, western blotting, and flow cytometry. It recognizes the antigen with high affinity and specificity, making it an essential tool for researchers in the Life Sciences field.
Purity:Min. 95%MCL1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug has been extensively studied using advanced techniques such as transcription-quantitative polymerase chain and patch-clamp technique, which have shown its efficacy in inhibiting bacterial growth. Additionally, it undergoes various metabolic transformations including hydrolysis by esterases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Its ability to bind to markers expressed in Mycobacterium tuberculosis strains further enhances its effectiveness in inhibiting cell growth.
TL1A antibody
TL1A antibody was raised in rabbit using highly pure recombinant human TL-1A as the immunogen.
Purity:Min. 95%FAK antibody
The FAK antibody is a highly specialized product in the field of Life Sciences. This monoclonal antibody plays a crucial role in various biological processes, including fatty acid metabolism, insulin signaling, and fibrinogen binding. It is designed to specifically target and bind to focal adhesion kinase (FAK), an important protein involved in cell adhesion and migration.
Purity:Min. 95%SET antibody
SET antibody was raised using the N terminal of SET corresponding to a region with amino acids IDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVT
Purity:Min. 95%Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productDengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
