Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
Ela1 antibody
Ela1 antibody was raised in rabbit using the middle region of Ela1 as the immunogenPurity:Min. 95%Ki67 antibody
The Ki67 antibody is a highly specialized product used in Life Sciences research. It is a monoclonal antibody produced by a hybridoma cell line, specifically designed for the immunohistochemical detection of activated cells. The Ki67 antibody targets the Ki67 protein, which is a marker of cellular proliferation and is commonly used as a growth factor indicator.
ITGA3 antibody
The ITGA3 antibody is a protein that belongs to the family of necrosis factor-related apoptosis-inducing proteins. It is a polyclonal antibody that can be used in various life science applications. The ITGA3 antibody has been shown to have an inhibitory effect on colony-stimulating factors and fibrinogen, which are important for cell growth and survival. This antibody can also activate phosphatase and 3-kinase pathways, which play a role in cellular signaling. Additionally, the ITGA3 antibody has been used as a monoclonal antibody to target TNF-related apoptosis-inducing molecules and inhibit their activity. Studies have also shown that this antibody can reduce microvessel density, suggesting its potential as an anti-angiogenic agent.
Bax antibody
The Bax antibody is a monoclonal antibody that specifically targets the protein Bax. Bax plays a crucial role in regulating cell death and apoptosis. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications.
LIMK1 antibody
The LIMK1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and bind to the LIMK1 protein, which plays a crucial role in cellular processes such as cell migration and cytoskeletal organization. This antibody can be used in various applications, including immunohistochemistry, Western blotting, and flow cytometry.
CD8a antibody (CY5)
CD8a antibody (CY5) was raised in mouse using trhe alpha chain of chicken CD8 as the immunogen.
Purity:Min. 95%UBE2L6 antibody
UBE2L6 antibody was raised using the middle region of UBE2L6 corresponding to a region with amino acids QVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRP
QTRT1 antibody
QTRT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KDKPRYLMGVGYATDLVVCVALGCDMFDCVFPTRTARFGSALVPTGNLQL
Goat anti Human IgG (H + L) (HRP)
Goat anti-human IgG (H+L) (HRP) was raised in goat using human IgG whole molecule as the immunogen.Purity:Min. 95%KSHV K8 alpha antibody
KSHV K8 alpha antibody was raised in Mouse using a purified recombinant fragment of KSHV K8alpha expressed in E. coli as the immunogen.TEX14 antibody
The TEX14 antibody is a protein that acts as a growth factor, specifically targeting epidermal growth factor and hepatocyte growth inhibitory factor. It is an essential component in the field of Life Sciences and is widely used in research studies. The TEX14 antibody can be utilized as both a monoclonal and polyclonal antibody, making it versatile for various applications. Its high specificity allows for accurate detection and analysis of c-myc expression levels. Additionally, the TEX14 antibody has been found to be effective in detecting autoantibodies, making it valuable in diagnostic testing. With its robust capabilities, this antibody is an indispensable tool for researchers in the field.
Donkey anti Rabbit IgG (H + L)
This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.Purity:Min. 95%SIVA1 antibody
The SIVA1 antibody is a highly specific monoclonal antibody that targets the biomolecule SIVA1. It is derived from isolated nucleic acids and collagen, making it a powerful tool for research in the field of Life Sciences. The SIVA1 antibody has been developed using cell hybridomas and chromatographic techniques to ensure high purity and specificity. It binds to hyaluronan receptors on the cell-extracellular matrix interface, allowing for precise detection and analysis of SIVA1 in various biological samples. This specific antibody can be used in applications such as immunohistochemistry, Western blotting, and ELISA assays to study the function and expression of SIVA1 in different cellular contexts. With its exceptional sensitivity and selectivity, the SIVA1 antibody is an invaluable asset for scientists seeking to unravel the complexities of cellular signaling pathways and protein interactions.
Rabbit anti Dog IgG (HRP)
Rabbit anti-dog IgG (HRP) was raised in rabbit using canine IgG F(ab')2 fragment as the immunogen.Purity:Min. 95%MRTO4 antibody
MRTO4 antibody was raised using a synthetic peptide corresponding to a region with amino acids EQFPHSMEPQLRQLGLPTALKRGVVTLLSDYEVCKEGDVLTPEQARVLKL
FBXL5 antibody
FBXL5 antibody was raised using the middle region of FBXL5 corresponding to a region with amino acids VHWARGDWYSGPATELDTEPDDEWVKNRKDESRAFHEWDEDADIDESEES
Delangin A antibody
Delangin A antibody was raised in Rat using Delangin peptide coupled to carrier protein as the immunogen.
TFPI antibody
TFPI antibody is a monoclonal antibody that targets tissue factor pathway inhibitor (TFPI), a protein involved in the regulation of blood clotting. TFPI antibody inhibits the activity of TFPI, which leads to increased blood clotting and reduced bleeding. This antibody has been shown to have anti-VEGF (vascular endothelial growth factor) properties, which may be beneficial in the treatment of diseases involving abnormal blood vessel growth, such as cancer and age-related macular degeneration. Additionally, TFPI antibody has been found to modulate hormone levels, including adipose and epidermal growth factors, which play important roles in various physiological processes. The use of TFPI antibody in Life Sciences research has also demonstrated its potential as a tool for studying the mechanisms of blood clotting and angiogenesis.
PKC alpha antibody
The PKC alpha antibody is a highly specialized antibody that targets the protein kinase C alpha (PKCα) enzyme. It is commonly used in life sciences research to study various cellular processes and signaling pathways. This monoclonal antibody specifically binds to the activated form of PKCα, allowing researchers to detect and analyze its activity in different cell types.
CD38 antibody (Spectral Red)
CD38 antibody (Spectral Red) was raised in rat using CD38 as the immunogen.
Purity:Min. 95%Molecular weight:0 g/molDengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productCA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
