Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
MTGR1 antibody
MTGR1 antibody was raised in Rat using MTGR1 peptide couple to carrier protein as the immunogen.
ABL2 antibody
ABL2 antibody was raised in Mouse using a purified recombinant fragment of ABL2 expressed in E. coli as the immunogen.
Calmodulin antibody
Calmodulin antibody was raised in mouse using calmodulin purified from Dictyostelium discoideum as the immunogen.
MTIF3 antibody
MTIF3 antibody was raised using the middle region of MTIF3 corresponding to a region with amino acids AVQGGKALMCVLRALSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ
MHC class II antibody
The MHC class II antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody specifically targets the antigen binding domain of MHC class II molecules, which play a crucial role in immune response regulation. By binding to these molecules, the antibody can modulate their activity and impact various biological processes.
CKB antibody
The CKB antibody is a polyclonal antibody that specifically targets the creatine kinase B (CKB) protein. This antibody is widely used in Life Sciences research to study various cellular processes and signaling pathways. The CKB protein plays a crucial role in energy metabolism by catalyzing the reversible transfer of phosphate between ATP and creatine, thus providing a readily available source of energy for cells. It is primarily expressed in tissues with high-energy demands, such as skeletal muscle, heart, and brain.
HAX1 antibody
The HAX1 antibody is an antiviral medication that acts as an inhibitor of methyl transferase. It plays a crucial role in the regulation of interleukin and serves as a serum marker in Life Sciences. This biomarker composition has been shown to be effective in detecting autoantibodies and is widely used in high-flux monoclonal antibody therapy. The HAX1 antibody is a potent medicament that targets specific cation channels and carnitine, making it an essential component for various medical applications. With its remarkable efficacy and versatility, the HAX1 antibody offers promising solutions for combating viral infections and promoting overall health.
COL11A1 antibody
The COL11A1 antibody is a monoclonal antibody specifically designed for Life Sciences research. It targets the antigen binding domain of COL11A1, a protein involved in various biological processes. This antibody is highly specific and can be used in a range of applications, including assays and biomolecule detection.
Ubiquitin antibody
The Ubiquitin antibody is a highly specific monoclonal antibody that targets the ubiquitin molecule. It is widely used in life sciences research for various applications, including immunoassays and the detection of target molecules. This antibody has been shown to have a high affinity for ubiquitin and can effectively detect its presence in samples.CACNB4 antibody
CACNB4 antibody was raised using the C terminal of CACNB4 corresponding to a region with amino acids LEAYWRATHTTSSTPMTPLLGRNLGSTALSPYPTAISGLQSQRMRHSNHS
TBCB antibody
TBCB antibody was raised using the C terminal of TBCB corresponding to a region with amino acids YDEPLGKNDGSVNGKRYFECQAKYGAFVKPAVVTVGDFPEEDYGLDEI
SH2 antibody
The SH2 antibody is a polyclonal antibody that has cytotoxic properties. It is commonly used in the field of Life Sciences for research purposes. This antibody specifically targets and inhibits the activity of family kinases, making it an effective inhibitor for various cellular processes. Additionally, the SH2 antibody has been shown to have neutralizing effects on proteins such as VEGF (vascular endothelial growth factor) and circumsporozoite protein. It can also be utilized in studies involving mesenchymal stem cells and has shown promising results in inhibiting their growth. The SH2 antibody is a valuable tool for researchers looking to study specific cellular pathways and investigate potential therapeutic targets.
MTCH2 antibody
MTCH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ADAASQVLLGSGLTILSQPLMYVKVLIQVGYEPLPPTIGRNIFGRQVCQL
MMP7 antibody
The MMP7 antibody is a highly specific monoclonal antibody that targets the matrix metalloproteinase 7 (MMP7) enzyme. MMP7 plays a crucial role in various biological processes, including tissue remodeling, wound healing, and cell proliferation. This antibody is widely used in Life Sciences research to study the function and regulation of MMP7.
DDOST antibody
DDOST antibody was raised using the N terminal of DDOST corresponding to a region with amino acids SPSVEDFGGNINVETISAFIDGGGSVLVAASSDIGDPLRELGSECGIEFD
Chicken anti Goat IgG (H + L) (rhodamine)
This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.
Purity:Min. 95%IL10 antibody
IL10 antibody is a medicament that belongs to the class of antibodies. It is a protein complex that specifically targets and binds to IL10, a cytokine involved in immune regulation. IL10 antibody can be used as a therapeutic agent for various diseases characterized by excessive IL10 activity, such as autoimmune disorders and inflammatory conditions. This monoclonal antibody has been extensively studied in the field of Life Sciences and has shown promising results in preclinical and clinical trials. It has the ability to neutralize the effects of IL10, thereby reducing its immunosuppressive and anti-inflammatory properties. IL10 antibody is also being investigated for its potential antiviral activity and its ability to enhance the effectiveness of multidrug therapies.
CD38 antibody
The CD38 antibody is a highly specialized monoclonal antibody that binds to CD38, a protein found on the surface of certain cells. This antibody has cytotoxic properties and can be used in various applications, including research and diagnostics. It specifically targets CD38-expressing cells and can be used to study their function or as a therapeutic agent.
Mouse Serum Albumin antibody
Mouse serum albumin antibody was raised in rabbit using mouse serum as the immunogen.Purity:Min. 95%HSPA1A antibody
The HSPA1A antibody is a monoclonal antibody that specifically targets the glycoprotein HSPA1A. This antibody has been shown to have multiple functions, including its ability to inhibit interferon and leukemia inhibitory factor signaling pathways. Additionally, it has been found to have antiphospholipid antibodies and antiviral activity. The HSPA1A antibody also acts as an inhibitor of dopamine release and exhibits cytotoxic effects on certain hormone peptides. Furthermore, it has been used as an anticoagulant in human serum and has been shown to target autoantibodies. With its diverse range of functions, the HSPA1A antibody holds great potential for various therapeutic applications.YAP1 antibody
The YAP1 antibody is a polyclonal antibody that specifically targets the YAP1 protein. This protein plays a crucial role in various cellular processes, including cell proliferation, differentiation, and apoptosis. The YAP1 antibody is designed to recognize and bind to the YAP1 protein, allowing for its detection and analysis in biological samples.
Human Serum Albumin antibody
Human serum albumin antibody was raised in mouse using human serum albumin as the immunogen.
