Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
Rel antibody
Rel antibody is a highly specialized product used in Life Sciences research. It is a polyclonal antibody that specifically targets and neutralizes the epidermal growth factor (EGF). This antibody is produced using state-of-the-art technology and contains high-quality excipients to ensure stability and efficacy. Rel antibody has been extensively tested and validated for use in various applications, including ELISA assays, Western blotting, immunohistochemistry, and more. It is highly specific and exhibits strong binding affinity towards EGF, making it a valuable tool for studying EGF-related signaling pathways. Whether you're investigating the role of EGF in cancer development or exploring its effects on insulin signaling, Rel antibody is an essential component of your research toolkit. Trust in its reliability and accuracy to enhance your scientific discoveries.
MEPE antibody
MEPE antibody was raised in rabbit using the middle region of MEPE as the immunogen
Purity:Min. 95%Goat anti Human Lambda Chain (Texas Red)
Goat anti-human lambda chain was raised in goat using human lambda light chain as the immunogen.
Purity:Min. 95%RBM5 antibody
The RBM5 antibody is a powerful antiviral agent that belongs to the family of antibodies. It specifically targets proteins such as anti-mesothelin and alpha-fetoprotein, which are known to play a crucial role in various diseases. The RBM5 antibody has been shown to have neutralizing effects on these proteins, preventing them from causing harm to the body.
LIAS antibody
LIAS antibody was raised using the N terminal of LIAS corresponding to a region with amino acids LLQNGPDLQDFVSGDLADRSTWDEYKGNLKRQKGERLRLPPWLKTEIPMG
PLXDC1 antibody
The PLXDC1 antibody is a powerful tool in the field of Life Sciences. It belongs to the category of Polyclonal Antibodies and has been extensively studied for its role in endothelial growth and angiogenesis. This antibody specifically targets PLXDC1, a receptor that plays a crucial role in regulating the growth and development of blood vessels.
A2M antibody
The A2M antibody is a powerful inhibitor of vascular endothelial growth factor (VEGF), which plays a crucial role in angiogenesis. It is also effective against other growth factors such as alpha-fetoprotein and erythropoietin. In addition, this antibody has been shown to inhibit the growth of Helicobacter, a bacteria that causes gastric ulcers. The A2M antibody works by binding to calmodulin, a protein involved in cell signaling, and preventing its activation. This inhibition leads to antiangiogenic effects and reduces the acidic environment necessary for tumor growth. Furthermore, the A2M antibody has anticoagulant properties that can be beneficial for patients with conditions such as heparin-induced thrombocytopenia. With its wide range of applications in life sciences, this polyclonal antibody is an essential tool for researchers and scientists working in various fields.
Purity:Min. 95%ORM2 antibody
The ORM2 antibody is a highly specialized monoclonal antibody that is used in various applications within the field of life sciences. This antibody specifically targets and reacts with the ORM2 protein, which is found in blood plasma and plays a crucial role in transporting fatty acids. The ORM2 antibody can be used in assays such as double-label immunofluorescence to detect the presence and localization of ORM2 protein in different cell types or tissues. It has also been utilized in studies involving pluripotent stem cells, where it helps identify specific markers such as neuronspecific enolase. With its high specificity and affinity, the ORM2 antibody provides researchers with a valuable tool for investigating the functions and interactions of this important protein.
PPM1G antibody
The PPM1G antibody is a highly effective medicament that has been extensively studied in various scientific fields, including hybridization and human hepatocytes. This antibody specifically targets pancreatic elastase, an enzyme involved in the breakdown of proteins in the pancreas. By inhibiting the activity of pancreatic elastase, this antibody can prevent cytotoxic effects and promote overall health.
RNF19A antibody
RNF19A antibody was raised using the N terminal of RNF19A corresponding to a region with amino acids IFSTNTSSDNGLTSISKQIGDFIECPLCLLRHSKDRFPDIMTCHHRSCVD
Purity:Min. 95%CYP1A1 antibody
The CYP1A1 antibody is a highly specific antibody that targets the cytochrome P450 1A1 enzyme. This enzyme plays a crucial role in the metabolism of various drugs and toxins in the body. The CYP1A1 antibody can be used in various research applications, including Western blotting, immunohistochemistry, and enzyme-linked immunosorbent assay (ELISA). It has been extensively validated for its specificity and sensitivity.
TAZ antibody
TAZ antibody was raised in rabbit using residures 386-400 [VESALNKSEPFLTWL] of the 49kDa human TAZ protein as the immunogen.
Purity:Min. 95%PSMA3 antibody
PSMA3 antibody was raised using a synthetic peptide corresponding to a region with amino acids VKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDN
CYP2J2 antibody
The CYP2J2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is specifically designed to target and detect the CYP2J2 enzyme, which plays a crucial role in the metabolism of drugs and other foreign substances in the body. This antibody is commonly used in studies involving mesenchymal stem cells, reactive oxygen species, and electrode-based assays.
NSUN4 antibody
NSUN4 antibody was raised using the N terminal of NSUN4 corresponding to a region with amino acids QKYGALVNNFAAWDHVSAKLEQLSAKDFVNEAISHWELQSEGGQSAAPSP
WFDC1 antibody
WFDC1 antibody was raised using the middle region of WFDC1 corresponding to a region with amino acids VAEGIPNRGQCVKQRRQADGRILRHKLYKEYPEGDSKNVAEPGRGQQKHF
SIGLEC9 antibody
The SIGLEC9 antibody is a monoclonal antibody that is used in immunoassays to detect autoantibodies in human serum. It can be immobilized on an electrode and used for the quantitation of specific markers or proteins. This antibody has anti-angiogenesis properties, making it valuable in research and potential treatment and/or prophylaxis of angiogenesis-related conditions. The SIGLEC9 antibody can be used in combination with streptavidin or other detection methods to enhance sensitivity and specificity in various life science applications. Its high affinity for histidine makes it an excellent tool for protein purification and analysis.
Cytokeratin 17 antibody
Cytokeratin 17 antibody was raised in mouse using human cytokeratin 17 as the immunogen.
Epor antibody
Epor antibody was raised in rabbit using the N terminal of Epor as the immunogen
Purity:Min. 95%PPIL3 antibody
PPIL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids NYYNGCIFHRNIKGFMVQTGDPTGTGRGGNSIWGKKFEDEYSEYLKHNVR
ALOX15 antibody
ALOX15 antibody was raised using the middle region of ALOX15 corresponding to a region with amino acids QHASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASLPurity:Min. 95%PDIA4 antibody
The PDIA4 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and bind to the PDIA4 antigen, which is an extracellular enzyme involved in various cellular processes. This antibody has been extensively tested and proven to be effective in detecting and quantifying PDIA4 levels in human serum samples.
TSH beta antibody F(ab)'2 Fragment
TSH beta antibody was raised against Human TSH (intact).
Purity:Min. 95%TACC3 antibody
The TACC3 antibody is a highly specialized monoclonal antibody that has receptor binding capabilities. It acts as a phosphatase, neutralizing specific targets in the body. This antibody is widely used in Life Sciences research and has shown promising results in various studies. It has been found to have an inhibitory effect on alpha-fetoprotein, a protein found in human serum that is associated with certain diseases. The TACC3 antibody can also block the activity of angptl3, a chemokine involved in inflammatory processes. With its immunosuppressant properties, this monoclonal antibody holds great potential for therapeutic applications and further exploration in the field of medicine.
PGR antibody
PGR antibody was raised in Mouse using a purified recombinant fragment of PGR(aa731-909) expressed in E. coli as the immunogen.STAT1 antibody
The STAT1 antibody is a powerful tool used in Life Sciences research for studying cellular signaling pathways and immune responses. It specifically targets the signal transducer and activator of transcription 1 (STAT1) protein, which plays a crucial role in mediating the effects of interferons and other cytokines.
