Primary Antibodies

<p>Rabbit polyclonal PSMG2 antibody</p>

<p>IL8 antibody was raised in Mouse using a purified recombinant fragment of human IL-8 expressed in E. coli as the immunogen.</p>

<p>Fibronectin antibody was raised in rabbit using fibronectin purified from human plasma as the immunogen.</p>

<p>HMGN4 antibody was raised in Rabbit using Human HMGN4 as the immunogen</p>

<p>ACADL antibody was raised using the middle region of ACADL corresponding to a region with amino acids LPQERLLIADVAISASEFMFEETRNYVKQRKAFGKTVAHLQTVQHKLAEL</p>

<p>Purified Rabbit polyclonal WRKY36.1 antibody</p>

<p>TYR antibody was raised using a synthetic peptide corresponding to a region with amino acids CLSLTQYESGSMDKAANFSFRNTLEGFASPLTGIADASQSSMHNALHIYM</p>

<p>Beta 2 Microglobulin Monoclonal Antibody</p>

<p>CD70 antibody was raised in rabbit using the N terminal of CD70 as the immunogen</p>

<p>Mouse monoclonal Calbindin D antibody</p>

<p>The p73 antibody is a monoclonal antibody that is used in Life Sciences research. It specifically targets and binds to the p73 protein, which is a member of the p53 family of transcription factors. This antibody can be used in various assays, including Western blotting, immunoprecipitation, and immunohistochemistry, to study the expression and function of p73 in different biological samples.</p>

<p>Rabbit polyclonal APC5 antibody (biotin)</p>

<p>C22orf28 antibody was raised in Rabbit using Human C22orf28 as the immunogen</p>

<p>PSMC5 antibody was raised in mouse using recombinant Human Proteasome (Prosome, Macropain) 26S Subunit, Atpase, 5 (Psmc5)</p>

<p>MRPS23 antibody was raised in Rabbit using Human MRPS23 as the immunogen</p>

<p>Rabbit polyclonal Histone H3 antibody (Thr11)</p>

<p>CD14 antibody was raised in Mouse using a purified recombinant fragment of human CD14 expressed in E. coli as the immunogen.</p>

<p>The RBBP7 antibody is a highly specialized product used in the field of Life Sciences. It plays a crucial role as a heparin cofactor, facilitating the binding and activation of various enzymes involved in important biological processes. This antibody specifically targets certain acid residues, allowing for precise assays and measurements in research and diagnostic settings.</p>

<p>Bradykinin Receptor B2 antibody was raised using the N terminal of BDKRB2 corresponding to a region with amino acids MFSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQV</p>

<p>Mouse monoclonal ASCC1 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, thereby inhibiting transcription and replication in the bacteria. Its effectiveness has been demonstrated through rigorous testing using the patch-clamp technique on human erythrocytes. The compound undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds to markers expressed in Mycobacterium tuberculosis strains and effectively inhibits their growth in culture.</p>

<p>ALDH3A1 antibody was raised in Rabbit using Human ALDH3A1 as the immunogen</p>

<p>CD81 antibody (Azide free) was raised in Hamster using Mouse epithelial cell line PAM212 as the immunogen.</p>

<p>VPS53 antibody was raised using a synthetic peptide corresponding to a region with amino acids VYIESQDKNLGELIDRFVADFKAQGPPKPNTDEGGAVLPSCADLFVYYKK</p>

<p>CKBB antibody was raised in mouse using human Brain CKBB as the immunogen.</p>

<p>RAE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEE</p>

<p>MYLK2 antibody was raised in Rabbit using Human MYLK2 as the immunogen</p>

<p>Rat monoclonal CD4 antibody (FITC); mouse target; IgG2b kappa; clone GK1.5</p>

<p>NAGK antibody was raised in Rabbit using Human NAGK as the immunogen</p>

<p>FBXO22 antibody was raised in Rabbit using Human FBXO22 as the immunogen</p>

<p>The CD117 antibody is a monoclonal antibody that specifically targets the CD117 protein, also known as c-Kit. This protein is a receptor tyrosine kinase that plays a crucial role in the activation of endogenous hematopoietic stem cells. The CD117 antibody has been extensively studied and proven to be highly effective in neutralizing the activity of CD117.</p>

<p>NDUFV1 antibody was raised in Rabbit using Human NDUFV1 as the immunogen</p>

<p>Rabbit polyclonal MP68 antibody (HRP)</p>

<p>PRDX6 antibody was raised using the C terminal of PRDX6 corresponding to a region with amino acids VATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP</p>

<p>Rabbit polyclonal SLC16A12 antibody</p>

<p>Rabbit polyclonal LKB1 antibody (Thr189)</p>

<p>Recombinant Human IFN-gamma</p>

<p>The Norovirus G2 antibody is a monoclonal antibody used in life sciences research. It specifically targets the G2 strain of the norovirus, which is a common cause of gastroenteritis. This antibody can be used to detect and study the protein expression of norovirus in various samples, including nuclear extracts, lysozyme, alpha-fetoprotein, and glycopeptides. The monoclonal antibody recognizes specific glycosylation patterns on the norovirus protein, allowing for accurate detection and analysis. It has also been used in studies related to androgen signaling in human serum and arginase activity. With its high specificity and sensitivity, this antibody is a valuable tool for researchers studying norovirus and its impact on human health.</p>

<p>Rabbit polyclonal Spermidine synthase antibody (FITC)</p>

<p>Rabbit polyclonal OR6C68 antibody</p>

<p>The Phospholamban antibody is a polyclonal antibody that is widely used in the field of Life Sciences. It has been specifically designed to target and neutralize phospholamban, an inhibitory factor involved in the regulation of calcium uptake and release in cardiac muscle cells. This antibody has been extensively tested and shown to effectively lyse phospholamban-expressing cells, making it a valuable tool for researchers studying the role of phospholamban in various physiological processes. Additionally, this antibody has also been found to have neutralizing effects on certain autoantibodies, such as antiphospholipid antibodies, and can modulate the activity of colony-stimulating factors like GM-CSF. With its high specificity and potency, the Phospholamban antibody is an essential component for any research project involving phospholamban or related proteins.</p>

<p>Affinity purified Rabbit polyclonal Inhibin beta A antibody</p>

<p>The NRG4 antibody is a highly specialized monoclonal antibody that targets and inhibits the activity of nuclear retinoid receptors. It has been extensively studied in the field of Life Sciences and has shown promising results as a potential therapeutic agent. The NRG4 antibody works by blocking the acetylation process that is crucial for the activation of retinoid receptors, thereby preventing their interaction with DNA and subsequent gene expression. This inhibition has been shown to have significant effects on various cellular processes, including collagen production, which makes it a valuable tool for studying and understanding the role of retinoids in cell biology. Additionally, the NRG4 antibody can be used in the development of novel medicines and vaccines targeting retinoid-related diseases and disorders. Its specificity and efficacy make it an essential component in research and diagnostic applications requiring reliable and accurate detection of retinoid receptors.</p>

<p>TRMU antibody was raised using the C terminal of TRMU corresponding to a region with amino acids ALATGQFAVFYKGDECLGSGKILRLGPSAYTLQKGQRRAGMATESPSDSP</p>

<p>C1ORF174 antibody was raised using the middle region of C1Orf174 corresponding to a region with amino acids EAGVSVQQGAASLPLGGCRVVSDSRLAKTRDGLSVPKHSAGSGAEESNSS</p>

<p>alpha 1 Antiplasmin antibody was raised in goat using human alpha 1 Antiplasmin purified from plasma as the immunogen.</p>

<p>The TFE3 antibody is a polyclonal antibody that specifically targets the beta-hairpin region of the TFE3 protein. This antibody is widely used in life sciences research, particularly in assays related to growth factors, insulin, and inhibitors. The TFE3 antibody has been shown to effectively detect and neutralize superoxide, making it a valuable tool for studying oxidative stress-related processes. Additionally, this antibody has demonstrated cytotoxic effects against cancer cells expressing high levels of c-myc and endothelial growth factors. Researchers also utilize the TFE3 antibody in anti-VEGF and erythropoietin studies. With its versatility and reliability, the TFE3 antibody is an essential component for various experiments in the field of life sciences.</p>

<p>HIV1 gp120 antibody (biotin) was raised in goat using purified native gp120 from strain IIIB as the immunogen.</p>

<p>ADSSL1 antibody was raised using the middle region of ADSSL1 corresponding to a region with amino acids VDGLQEVQRQAQEGKNIGTTKKGIGPTYSSKAARTGLRICDLLSDFDEFS</p>

<p>Rabbit polyclonal PIK3CB antibody</p>

<p>The LECT2 antibody is a highly specific monoclonal antibody that has been developed for use in the field of Life Sciences. It is designed to target and bind to LECT2 (leukocyte cell-derived chemotaxin 2), a protein found in human serum. This antibody can be used in various applications, including immunohistochemistry, Western blotting, and ELISA assays.</p>

<p>The MTH1 antibody is a growth factor that plays a crucial role in various biological processes. It acts as a neutralizing agent against chemokines, helicobacter proteins, and TGF-beta. This monoclonal antibody is widely used in the field of Life Sciences for its ability to target specific molecules and inhibit their activity. Additionally, the MTH1 antibody has been shown to have therapeutic potential when combined with other drugs such as olaparib. It can also be used as a research tool for studying phosphatase activity, ferritin levels, interleukin-6 signaling, collagen synthesis, and immobilization processes. With its versatility and specificity, the MTH1 antibody is an essential tool for researchers in various fields.</p>

<p>Mouse monoclonal ITFG2 antibody</p>

<p>Purified Polyclonal RAD1 antibody</p>

<p>ARHGEF10 antibody was raised in Rabbit using Human ARHGEF10 as the immunogen</p>

<p>HGD antibody was raised in Rabbit using Human HGD as the immunogen</p>

<p>The LXN antibody is a monoclonal antibody that is used to detect and study angiogenic factors. It can be used in various research applications, including immunohistochemistry and Western blotting. The LXN antibody specifically recognizes and binds to a target protein, allowing for the detection and analysis of its expression levels. This antibody has been shown to inhibit syncytia formation and block the activity of certain growth factors. Additionally, it has been found to have cholinergic activity and can modulate the function of nucleotide molecules. The LXN antibody is available as a ready-to-use solution and can be easily incorporated into experimental protocols.</p>

<p>Rabbit polyclonal RPS25 antibody (FITC)</p>

<p>The GLUT1 antibody is a highly specialized antibody that plays a crucial role in sugar transport across cell membranes. It is commonly used in various scientific and medical research applications. This antibody specifically targets the glucose transporter protein 1 (GLUT1), which is responsible for transporting glucose into cells.</p>

<p>CAPN2 antibody was raised in Rabbit using Human CAPN2 as the immunogen</p>

<p>Rabbit polyclonal ACOT1 antibody</p>

<p>Mouse monoclonal HAG2 antibody</p>

<p>Affinity purified Rabbit polyclonal XPNPEP2 antibody</p>

<p>Tubulin antibody was raised in mouse using Chicken skeletal muscle cell preparation as the immunogen.</p>

<p>Carbonic Anhydrase VIII antibody was raised using the N terminal of CA8 corresponding to a region with amino acids YEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDC</p>

<p>The NR1H3 antibody is a highly specialized monoclonal antibody that targets the chemokine receptor NR1H3. This receptor plays a crucial role in the immune response to viral infections by regulating the activity of serine proteases and other key molecules involved in antiviral defense. The NR1H3 antibody has been extensively studied and proven to be effective in neutralizing the activity of NR1H3, thereby inhibiting viral replication and spread.</p>

<p>Rabbit Polyclonal GIMAP2 antibody</p>

<p>Rabbit polyclonal ZNF75 antibody</p>

<p>The SERP1 antibody is a polyclonal antibody that targets nuclear and adipose tissues. It is widely used in life sciences research for its neutralizing properties against glycoproteins. This antibody has been shown to be effective in inhibiting connexin agents and promoting endothelial growth. It can also be used as a diagnostic tool for detecting alpha-fetoprotein levels in human serum. The SERP1 antibody is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs. With its high specificity and affinity, this antibody is an essential tool for studying various biological processes and diseases.</p>

<p>The CBP80 antibody is a protein that specifically targets and binds to the CBP80 protein. It has been shown to have autoantibodies against basic proteins and TNF-related apoptosis-inducing ligand (TRAIL), which are growth factors involved in cell death regulation. The CBP80 antibody can be used in various research applications, such as immunohistochemistry, Western blotting, and ELISA assays. It is commonly used to detect the presence of specific proteins in biological samples, including human serum or tissue extracts. This antibody is a valuable tool for researchers in the life sciences field who are studying various target molecules, such as alpha-fetoprotein or erythropoietin.</p>

<p>KLHL35 antibody was raised in Rabbit using Human KLHL35 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal GRB10 antibody</p>

<p>HSPB11 antibody was raised in Rabbit using Human HSPB11 as the immunogen</p>

<p>MSRA antibody was raised in Rabbit using Human MSRA as the immunogen</p>

<p>TGS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids IDENPASDFDDSGSLLGFKYGSGQKYGGIPNFSHRQVRYLEKNVKLKSKY</p>

<p>The FHL2 antibody is a powerful tool in the field of life sciences. It is an anti-CD33 antibody that has antiviral properties and can be used to neutralize the effects of certain viruses. This monoclonal antibody specifically targets CD33, a cell surface receptor involved in immune responses. By binding to CD33, the FHL2 antibody can block its interaction with other molecules, preventing viral entry into host cells.</p>

<p>Mouse monoclonal PDE2A antibody</p>

<p>The SMS antibody is a highly specialized monoclonal antibody that has lysine-specific and neutralizing properties. This antibody targets the IFN-gamma growth factor, which plays a crucial role in regulating immune responses. By specifically binding to IFN-gamma, the SMS antibody can modulate its activity and potentially inhibit its effects.</p>

<p>ATP6V1B2 antibody was raised using the middle region of ATP6V1B2 corresponding to a region with amino acids NFIAQGPYENRTVFETLDIGWQLLRIFPKEMLKRIPQSTLSEFYPRDSAK</p>

<p>The Parkin antibody is a powerful tool used in Life Sciences research. It is a monoclonal antibody that specifically targets the Parkin protein, which plays a crucial role in cellular processes such as adiponectin regulation and growth factor signaling. This antibody has been extensively validated for use in various applications, including Western blotting, immunohistochemistry, and ELISA.</p>

<p>Rabbit Polyclonal Catenin alpha antibody (Ser641)</p>

<p>Rabbit polyclonal SURF2 antibody</p>

<p>The ASS1 antibody is a monoclonal antibody that targets the argininosuccinate synthase 1 (ASS1) protein. This protein plays a crucial role in the production of arginine, an amino acid that is essential for various biological processes. The ASS1 antibody can be used in research and diagnostic applications to study the expression and localization of ASS1 in different tissues and cell types.</p>

<p>The CD61 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to specifically target and bind to the CD61 protein, which is found on the surface of certain cells. This antibody has been extensively studied for its cytotoxic and nephrotoxic properties, making it a valuable tool for research purposes.</p>

<p>ARL3 antibody was raised in Rabbit using Human ARL3 as the immunogen</p>

<p>The OR8D1 antibody is a monoclonal antibody that has shown promising results in various studies. It has been found to have neutralizing effects on phorbol-induced cell proliferation in carcinoma cell lines. Additionally, this antibody has been extensively used in polymerase chain reaction (PCR) experiments in Life Sciences research.</p>

<p>BATF antibody was raised in Rabbit using Human BATF as the immunogen</p>

<p>Rabbit Polyclonal LDHAL6A antibody</p>

<p>Mouse monoclonal CD106 antibody (biotin)</p>

<p>PRMT5 antibody was raised using the N terminal of PRMT5 corresponding to a region with amino acids  FDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLS</p>

<p>The B71 antibody is a monoclonal antibody that plays a crucial role in various biological processes. It specifically targets the B7-1 protein, which is involved in immune responses and cell signaling. This antibody can be used in research and diagnostic applications to study the expression and function of B7-1. The B71 antibody has been widely used in the field of life sciences to investigate the role of B7-1 in diseases such as cancer, autoimmune disorders, and infectious diseases. Its high specificity and affinity make it an invaluable tool for researchers studying immune regulation and therapeutic development. Whether you're working on basic research or developing new therapies, the B71 antibody is an essential resource for your studies.</p>

<p>CAPN7 antibody was raised in Rabbit using Human CAPN7 as the immunogen</p>

<p>Mouse monoclonal Bt Cry1Ab/Ac antibody</p>

<p>Mouse monoclonal MIER2 antibody</p>

<p>Purified Rabbit polyclonal SYK antibody (Tyr352)</p>

<p>Rabbit polyclonal MSK2 antibody (Thr568)</p>

<p>Rabbit polyclonal UQCRQ antibody</p>

<p>The ORM2 antibody is a highly specialized monoclonal antibody that is used in various applications within the field of life sciences. This antibody specifically targets and reacts with the ORM2 protein, which is found in blood plasma and plays a crucial role in transporting fatty acids. The ORM2 antibody can be used in assays such as double-label immunofluorescence to detect the presence and localization of ORM2 protein in different cell types or tissues. It has also been utilized in studies involving pluripotent stem cells, where it helps identify specific markers such as neuronspecific enolase. With its high specificity and affinity, the ORM2 antibody provides researchers with a valuable tool for investigating the functions and interactions of this important protein.</p>

<p>MRPS27 antibody was raised in Rabbit using Human MRPS27 as the immunogen</p>

<p>Rabbit polyclonal SRRM1 antibody</p>