Primary Antibodies

<p>Rabbit polyclonal SRPRB antibody</p>

<p>Rabbit Polyclonal OR10H4 antibody</p>

<p>Mouse monoclonal LEMD3 antibody</p>

<p>Rabbit polyclonal SRA1 antibody</p>

<p>Rabbit polyclonal alpha Synuclein antibody (Tyr125)</p>

<p>The alpha Synuclein antibody is a powerful tool used in life sciences research. This monoclonal antibody specifically targets and binds to alpha Synuclein, a protein associated with neurodegenerative diseases such as Parkinson's disease. By targeting this protein, the antibody allows researchers to study its role in the development and progression of these diseases.</p>

<p>Mouse monoclonal DYNC1LI1 antibody</p>

<p>The Caspase 3 antibody is a highly specific monoclonal antibody that is widely used in Life Sciences research. It is designed to target and detect the activity of caspase enzymes, which play a crucial role in programmed cell death (apoptosis). This antibody has been extensively validated for its specificity and sensitivity.</p>

<p>CD44 Monoclonal Antibody (RPE)</p>

<p>Rabbit polyclonal SH3GL2 antibody</p>

<p>HEPH antibody was raised in Rabbit using Human HEPH as the immunogen</p>

<p>GRPEL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NSGQNLEEDMGQSEQKADPPATEKTLLEEKVKLEEQLKETVEKYKRALAD</p>

<p>Mouse monoclonal MTMR14 antibody</p>

<p>MACF1 antibody was raised in Rabbit using Human MACF1 as the immunogen</p>

<p>NOC4L antibody was raised using a synthetic peptide corresponding to a region with amino acids CRVLVHRPHGPELDADPYDPGEEDPAQSRALESSLWELQALQRHYHPEVS</p>

<p>Rabbit polyclonal STARD3NL antibody</p>

<p>GSTM5 antibody was raised using the N terminal of GSTM5 corresponding to a region with amino acids MPMTLGYWDIRGLAHAIRLLLEYTDSSYVEKKYTLGDAPDYDRSQWLNEK</p>

<p>Recombinant human IL-1beta</p>

<p>The SST antibody is a monoclonal antibody that specifically targets amyloid plaques, which are protein clumps commonly associated with neurodegenerative diseases such as Alzheimer's. This antibody has been extensively used in Life Sciences research to study the formation and progression of these plaques. In addition to its use in research, the SST antibody can also be used in diagnostic applications for detecting the presence of amyloid plaques in patient samples. It has shown high specificity and sensitivity when tested against various forms of amyloid proteins. Furthermore, the SST antibody has demonstrated anti-angiogenesis properties, making it a potential therapeutic option for diseases characterized by abnormal blood vessel growth. With its ability to bind to low-molecular-weight compounds and activated surfaces, this antibody is a versatile tool for studying protein interactions and developing new treatments.</p>

<p>Rabbit polyclonal YBX2 antibody</p>

<p>Rabbit polyclonal ZFYVE9 antibody</p>

<p>Mouse monoclonal RALBP1 antibody</p>

<p>Dopamine Transporter Monoclonal Antibody (HRP)</p>

<p>The ILK antibody is a powerful tool used in scientific research and diagnostics. This monoclonal antibody specifically targets ILK (Integrin-Linked Kinase), a key protein involved in various cellular processes. It plays a crucial role in cell adhesion, migration, proliferation, and survival.</p>

<p>CYP26B1 antibody was raised using the middle region of CYP26B1 corresponding to a region with amino acids SRFELATRTFPRITLVPVLHPVDGLSVKFFGLDSNQNEILPETEAMLSAT</p>

<p>The CD1d antibody is a highly specialized monoclonal antibody that has neutralizing properties. It is commonly used in the field of Life Sciences for various applications, including immobilization on electrodes, detection of human serum markers, and inhibition of endothelial growth. This monoclonal antibody exhibits antiangiogenic effects by targeting specific markers involved in blood vessel formation.</p>

<p>The MMP2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It binds specifically to matrix metalloproteinase 2 (MMP2), an enzyme responsible for the degradation of collagen in the extracellular matrix. This antibody is widely used in studies involving tissue remodeling, wound healing, and cancer metastasis.</p>

<p>Rabbit polyclonal OR2T3 antibody</p>

<p>MCL1 antibody was raised in Rabbit using Human MCL1 as the immunogen</p>

<p>Mouse monoclonal SCHIP1 antibody</p>

<p>The SCNN1A antibody is a highly effective inhibitor that targets β-catenin, an essential protein involved in various cellular processes. This antibody is widely used in the Life Sciences field for research purposes and has shown significant potential as a therapeutic agent. It acts as an HDAC inhibitor, inhibiting histone deacetylase activity and promoting gene expression. Additionally, the SCNN1A antibody exhibits potent inhibitory effects on methyl transferase and 6-phosphogluconate dehydrogenase enzymes, which are crucial for cell metabolism.</p>

<p>The SEC61G antibody is a highly specialized antibody that targets the mitogen-activated protein SEC61G. It is widely used in Life Sciences research and has been proven to be an effective tool in studying protein inhibitors and their mechanisms of action. This polyclonal antibody specifically binds to SEC61G, allowing researchers to investigate its role in various cellular processes.</p>

<p>The VPS26B antibody is a powerful tool used in Life Sciences research. It plays a crucial role in inhibiting the growth factor signaling pathway, particularly endothelial growth. This antibody acts as a neutralizing agent, preventing the activation of angiogenic processes.</p>

<p>The SNAP antibody is a polyclonal antibody used in Life Sciences research. It is specifically designed to neutralize the epidermal growth factor (EGF), a low-molecular-weight growth factor involved in various cellular processes. This antibody can be used to study the function and regulation of EGF in different experimental settings. Additionally, the SNAP antibody can also be used for the detection and quantification of EGF levels in biological samples. With its high specificity and sensitivity, this antibody is an essential tool for researchers working on EGF-related studies.</p>

<p>Rabbit polyclonal KCNB1 antibody</p>

<p>Rabbit Polyclonal MYPT1 antibody (Thr853)</p>

<p>Rabbit polyclonal THEM2 antibody</p>

<p>The STX16 antibody is a highly specialized monoclonal antibody that has cytotoxic properties. It targets pancreatic glucagon and erythropoietin, which are autoantibodies associated with certain diseases in the Life Sciences field. This antibody has been specifically designed to bind to activated glucagon and erythropoietin, inhibiting their function and preventing further damage. Additionally, the STX16 antibody can also target other proteins such as skeletal myosin, β-catenin, and cardiomyocyte markers. This makes it a versatile tool for research purposes in various fields including molecular biology, immunology, and cell biology. With its high specificity and affinity, the STX16 antibody is an essential component for any laboratory or research facility looking to investigate the role of these proteins in disease development and progression.</p>

<p>The SLC25A24 antibody is a highly specialized protein reagent used in Life Sciences research. It is a monoclonal antibody that has been developed for its antitumor and antiviral properties. This antibody specifically targets the SLC25A24 protein, which is involved in hematopoietic and extracellular functions.</p>

<p>Mouse monoclonal MAPK6 antibody</p>

<p>The Chk1 antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to the phosphatase Chk1. This antibody has been extensively studied and proven to be highly effective in various research applications.</p>

<p>Rabbit polyclonal GPR37 antibody</p>

<p>Rabbit polyclonal TP53I11 antibody</p>

<p>Rabbit polyclonal POTED antibody</p>

<p>Rabbit polyclonal Estrogen Receptor beta antibody (Ser105)</p>

<p>Rabbit polyclonal MAP3K8 antibody (Ser400)</p>

<p>MTCH2 antibody was raised in Rabbit using Human MTCH2 as the immunogen</p>

<p>FABP1 antibody was raised using the N terminal of FABP1 corresponding to a region with amino acids MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKF</p>

<p>Mouse monoclonal PDE2A antibody</p>

<p>Mouse monoclonal PSMB7 antibody</p>

<p>DDB2 antibody was raised in mouse using recombinant Human Damage-Specific Dna Binding Protein 2, 48Kda (Ddb2)</p>

<p>The JAml antibody is a highly effective medicament that consists of monoclonal antibodies. These antibodies are specifically designed to target and bind to nuclear proteins, making them ideal for various biochemical applications. The JAml antibody has been extensively tested and proven to be highly specific and sensitive in detecting the presence of helicobacter in samples. It can also be used to study the activation of various cellular pathways, as it binds to an amide group found in activated proteins. Additionally, the JAml antibody has shown promising results in regulating e-cadherin expression, a glycoprotein involved in cell adhesion. With its colloidal microsphere formulation, this antibody is easy to use and delivers accurate results. Whether you're conducting research or working in the field of life sciences, the JAml antibody is an indispensable tool for your laboratory.</p>

<p>Mouse monoclonal GLP1 antibody (Biotin)</p>

<p>TTC6 antibody was raised using the C terminal of TTC6 corresponding to a region with amino acids MKDYQDAITLNPKYSLAYFNAGNIYFHHRQFSQASDYFSKALKFDPENEY</p>

<p>Purified Polyclonal CEBP delta/epsilon antibody</p>

<p>Mouse monoclonal OGFOD1 antibody</p>

<p>The CPA1 antibody is a monoclonal antibody that specifically targets the CPA1 enzyme. This antibody has been extensively studied for its protease activity and its potential applications in the field of life sciences. It has been shown to effectively inhibit the activity of CPA1, which plays a crucial role in various physiological processes.</p>

<p>Rabbit polyclonal ELOVL3 antibody</p>

<p>The TLR7 antibody is a powerful tool in the field of life sciences. This antibody specifically targets Toll-like receptor 7 (TLR7), which plays a crucial role in the immune response to viral infections. The TLR7 antibody is designed to bind to TLR7 and block its activity, preventing the activation of downstream signaling pathways.</p>

<p>NOL5A antibody was raised using a synthetic peptide corresponding to a region with amino acids EERLSFYETGEIPRKNLDVMKEAMVQAEEAAAEITRKLEKQEKKRLKKKK</p>

<p>The NEUROG3 antibody is a highly specialized cytotoxic agent that targets dinitrophenyl (DNP) antigens. It is a monoclonal antibody that has been extensively studied in the field of Life Sciences. This antibody has shown strong binding affinity to DNP antigens, leading to the lysis of cells expressing these antigens. The NEUROG3 antibody can be used in various research applications, including immunohistochemistry, flow cytometry, and Western blotting. Its unique glycosylation pattern ensures optimal binding and specificity. Additionally, this antibody has been shown to inhibit endothelial growth and interfere with β-catenin signaling pathways. With its potent cytotoxic properties and broad range of applications, the NEUROG3 antibody is a valuable tool for researchers in the field of enteroendocrine biology and beyond.</p>

<p>FGF18 antibody is a polyclonal antibody that targets fibroblast growth factor 18 (FGF18). FGF18 is involved in various biological processes, including hepatocyte growth, tissue repair, and development. This antibody has been shown to have high specificity and affinity for FGF18, making it a valuable tool in life sciences research.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been demonstrated using advanced techniques such as the patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting their growth in culture.</p>

<p>The FR alpha antibody is a monoclonal antibody that specifically targets the FR alpha protein. This protein plays a crucial role in various biological processes, including fibrinogen binding, chemokine signaling, and E-cadherin-mediated cell adhesion. The FR alpha antibody is widely used in life sciences research to study the function and regulation of this protein.</p>

<p>GLRA3 antibody was raised in Rabbit using Human GLRA3 as the immunogen</p>

<p>The GPR34 antibody is a powerful tool in the field of Life Sciences and is widely used in research and diagnostic applications. This polyclonal antibody specifically targets GPR34, an antigen that plays a crucial role in various cellular processes. When activated, GPR34 triggers a cascade of events that regulate tyrosine phosphorylation and intracellular signaling pathways.</p>

<p>Rabbit polyclonal USF2 antibody</p>

<p>ACTR3B antibody was raised using a synthetic peptide corresponding to a region with amino acids DHYFLMTEPPLNTPENREYLAEIMFESFNVPGLYIAVQAVLALAASWTSR</p>

<p>The cRAF antibody is a fatty acid-based medicament that is widely used in the Life Sciences field. It belongs to the category of antibodies, specifically Polyclonal Antibodies. This antibody is highly effective against activated cRAF, which is a key enzyme involved in various cellular processes. The cRAF antibody has been shown to neutralize the activity of cRAF by binding to its active site and preventing its interaction with downstream signaling molecules. Additionally, this antibody has demonstrated excellent specificity, as it does not cross-react with other proteins such as glial fibrillary acidic protein or EGF-like glycoprotein. Its neutralizing properties make it an ideal tool for studying the role of cRAF in different cell types and physiological conditions.</p>

<p>Purified Polyclonal NFYC antibody</p>

<p>The ACY1 antibody is a potent colony-stimulating factor that is derived from pluripotent stem cells. It is widely used in the field of Life Sciences for various applications. The ACY1 antibody has been shown to have a high affinity for collagen and can be used in antigen-antibody reactions. It is commonly used in research studies to detect the presence of specific proteins or molecules in samples. The ACY1 antibody is produced using a monoclonal antibody technique, ensuring high specificity and consistency. This mouse monoclonal antibody has shown neutralizing properties against parathyroid hormone-related peptide and can effectively inhibit its activity. Additionally, the ACY1 antibody can bind to membrane collagen and cell antibodies, making it a valuable tool for studying cellular processes and interactions.</p>

<p>Purified Polyclonal PLC gamma 1 antibody</p>

<p>GRAP antibody was raised using the middle region of GRAP corresponding to a region with amino acids KRQIFLRDEEPLLKSPGACFAQAQFDFSAQDPSQLSFRRGDIIEVLERPD</p>

<p>The AhR antibody is a monoclonal antibody that specifically targets and neutralizes the aryl hydrocarbon receptor (AhR). This protein complex plays a crucial role in various biological processes, including cell growth and differentiation. By inhibiting the activation of AhR, this antibody prevents the downstream signaling events that are triggered by its activation.</p>

<p>Rat monoclonal TRANCE antibody (PE)</p>

<p>OSBPL3 antibody was raised using the N terminal of OSBPL3 corresponding to a region with amino acids MMSDEKNLGVSQKLVSPSRSTSSCSSKQGSRQDSWEVVEGLRGEMNYTQE</p>

<p>Purified Rabbit polyclonal CGREF1 antibody</p>

<p>The KCNA3 antibody is a specific antibody that targets the KCNA3 protein. This protein plays a crucial role in various cellular processes, including cell signaling and ion channel regulation. The KCNA3 antibody is widely used in life sciences research to study the function of this protein and its involvement in different diseases.</p>

<p>The beta Tubulin antibody is a highly specific monoclonal antibody that targets the beta-tubulin protein. This protein plays a crucial role in cell division and is essential for the formation of microtubules, which are involved in various cellular processes such as intracellular transport and cell shape maintenance.</p>

<p>The SKP2 antibody is a monoclonal antibody that specifically targets and inhibits the activity of SKP2 (S-phase kinase-associated protein 2). SKP2 is a nuclear protein that plays a crucial role in regulating cell cycle progression by promoting the degradation of key cell cycle inhibitors. By blocking the function of SKP2, this antibody helps to prevent uncontrolled cell growth and proliferation.</p>

<p>Purified Rabbit polyclonal PIK3R1 antibody</p>

<p>FN3KRP antibody was raised using the N terminal of FN3KRP corresponding to a region with amino acids MDPGDPAGDPAAGERHRMGRDPLLLLQALQTLWSTRERKQLREEAWRGFA</p>

<p>Rabbit polyclonal YES1 antibody</p>

<p>Mouse monoclonal DENV1 ED3 antibody</p>

<p>Mouse monoclonal Notch 1 antibody (PE)</p>

<p>GFP antibody (HRP) was raised in goat using a GFP fusion protein corresponding to the full length amino acid sequence (246aa) derived from the jellyfish Aequorea victoria as the immunogen.</p>

<p>Rabbit polyclonal RSK1/2/3/4 antibody</p>

<p>COX4I1 antibody was raised in Mouse using a purified recombinant fragment of human COX4I1 expressed in E. coli as the immunogen.</p>

<p>HAO2 antibody was raised using a synthetic peptide corresponding to a region with amino acids DDNIAAFKRIRLRPRYLRDVSEVDTRTTIQGEEISAPICIAPTGFHCLVW</p>

<p>The AURKA antibody is a highly effective neutralizing agent used in Life Sciences research. It belongs to a class of inhibitors that target specific proteins involved in cellular processes. This monoclonal antibody has been extensively tested and proven to be highly cytotoxic against various cancer cell lines. In addition, it has shown promising results in inhibiting the growth factor signaling pathway and blocking the activity of leukemia inhibitory factor. The AURKA antibody is derived from human serum and exhibits excellent specificity and affinity for its target protein. Its colloidal nature allows for easy handling and application in various experimental setups. Researchers can rely on this monoclonal antibody to accurately detect and quantify the presence of hormone peptides, autoantibodies, and other biomolecules of interest.</p>

<p>The AR antibody is a monoclonal antibody that specifically targets the androgen receptor (AR). It has been extensively studied and proven to be highly effective in various research applications within the Life Sciences field. The AR antibody can be used for experiments involving alpha-fetoprotein, endogenous hematopoietic cells, epidermal growth factor signaling, actin filaments, growth factors, fibronectin, chemokines, antibodies, interferon-gamma (IFN-gamma), human folate metabolism, and many other areas of study.</p>

<p>The PAR4 antibody is a potent antiviral agent that belongs to the class of antibodies. It is available in both polyclonal and monoclonal forms, with the monoclonal antibody being highly neutralizing. This antibody specifically targets the PAR4 receptor, which is involved in various cellular processes such as cyclase-activating and ketamine signaling. In the field of Life Sciences, this antibody is widely used for research purposes due to its high specificity and affinity for PAR4. It can be utilized for studying biomolecules like transferrin, low density lipoprotein (LDL), globulin, and erythropoietin. The PAR4 antibody is also commonly used in immunoassays and other analytical techniques to detect and quantify PAR4 levels. Its colloidal properties make it suitable for various applications in the biomedical field.</p>

<p>MC4R antibody is a polyclonal antibody that specifically targets the melanocortin 4 receptor (MC4R). It is widely used in life sciences research to study adipose tissue and its related functions. This antibody has been shown to have neutralizing properties against angptl3, a protein involved in lipid metabolism. The MC4R antibody can be used in various applications such as immunohistochemistry, western blotting, and enzyme-linked immunosorbent assay (ELISA). It is available in both monoclonal and polyclonal forms, allowing researchers to choose the most suitable option for their experiments. With its high specificity and sensitivity, the MC4R antibody is an essential tool for studying the role of MC4R in various physiological processes and developing potential therapeutic interventions.</p>

<p>LAMP2 antibody was raised in Rabbit using Human LAMP2 as the immunogen.<br>Functions by binding target proteins, such as GAPDH and MLLT11, and targeting them for lysosomal degradation. Plays a role in lysosomal protein degradation in response to starvation.</p>

<p>MLF1 antibody was raised in Rabbit using Human MLF1 as the immunogen</p>

<p>Purified Rabbit polyclonal DDX54 antibody</p>

<p>Purified Rabbit polyclonal ELOVL6 antibody</p>

<p>The AK1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is specifically designed to target and detect collagen, making it an essential tool for studying collagen-related processes. This antibody is commonly used in immunoassays and other experimental techniques to detect the presence of collagen in various samples.</p>

<p>Mouse monoclonal EPN2 antibody</p>

<p>Mouse monoclonal GSTO2 antibody</p>