Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,606 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(746 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,781 products)
- Metabolism Antibodies(277 products)
- Microbiology Antibodies(736 products)
- Signal Transduction(2,710 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 69953 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Annexin VII antibody
<p>The Annexin VII antibody is a highly specialized antibody used in the field of Life Sciences. It has cytotoxic properties and acts as a growth factor, promoting cell proliferation and survival. This antibody is capable of neutralizing the activity of adipose lipase, an enzyme involved in the breakdown of fats. It belongs to the class of Polyclonal Antibodies, which are produced by multiple B-cell clones and recognize different epitopes on the target protein. The Annexin VII antibody also exhibits natriuretic effects and has been shown to be effective against multidrug-resistant bacteria. Additionally, it can be used as a monoclonal antibody for targeted therapy or as an antibiotic to inhibit the growth of lipoprotein lipase and triglyceride lipase, enzymes involved in lipid metabolism.</p>ApoBEC2 antibody
<p>ApoBEC2 antibody was raised using the middle region of APOBEC2 corresponding to a region with amino acids CKLRIMKPQDFEYVWQNFVEQEEGESKAFQPWEDIQENFLYYEEKLADIL</p>SF1 antibody
<p>SF1 antibody was raised using the C terminal of SF1 corresponding to a region with amino acids APPPPPPPPPGSAGMMIPPRGGDGPSHESEDFPRPLVTLPGRQPQQRPWW</p>HCII antibody (HRP)
<p>HCII antibody (HRP) was raised in goat using human HCII purified from plasma as the immunogen.</p>CD16 antibody
<p>CD16 antibody was raised in mouse using human polymorphonuclear leukocytes as the immunogen.</p>NPHS2 antibody
<p>The NPHS2 antibody is a highly specialized antibody that exhibits antiangiogenic activity. It belongs to the class of growth factors and is commonly used in the field of Life Sciences. This antibody is available in both polyclonal and monoclonal forms, allowing for versatility in research applications.</p>hnRNP L Antibody
<p>The hnRNP L Antibody is a highly specialized product in the field of Life Sciences. This monoclonal antibody is specifically designed to target and bind to hnRNP L, a protein involved in various cellular processes. It has been extensively tested and validated for its efficacy in research applications.</p>OLFM4 antibody
<p>OLFM4 antibody was raised using the C terminal of OLFM4 corresponding to a region with amino acids EEIFYYYDTNTGKEGKLDIVMHKMQEKVQSINYNPFDQKLYVYNDGYLLN</p>Factor IX antibody (HRP)
<p>Factor IX antibody (HRP) was raised in goat using human Factor IX purified from plasma as the immunogen.</p>CFDP1 antibody
<p>CFDP1 antibody was raised using the middle region of CFDP1 corresponding to a region with amino acids GSGLKRSSGMSSLLGKIGAKKQKMSTLEKSKLDWESFKEEEGIGEELAIH</p>HNF4 α antibody
<p>The HNF4 alpha antibody is a highly effective reagent used in the field of Life Sciences. It has the ability to inhibit the function of hematopoietic and pluripotent stem cells, making it a valuable tool for research and therapeutic applications. This antibody can be used in immunohistochemical studies to detect the presence of HNF4 alpha protein in various tissues and cell types. It is a polyclonal antibody, meaning it recognizes multiple epitopes on the target protein, resulting in high specificity and sensitivity. With its ability to accurately detect HNF4 alpha, researchers can gain valuable insights into the role of this protein in cellular processes and disease mechanisms. Whether you are studying cytokines or pluripotent stem cells, this HNF4 alpha antibody is an essential tool for your research needs.</p>Zika virus NS1 antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the rifamycins class. It is specifically designed to combat tuberculosis infections by targeting active compounds and exerting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication of bacteria. Its effectiveness has been extensively studied using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. Additionally, it undergoes various metabolic transformations such as hydrolysis by esterases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, this drug specifically binds to markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture.</p>GLS2 antibody
<p>GLS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids FVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDF</p>SARS-CoV-2 Spike Antibody
<p>The SARS-CoV-2 Spike Antibody is a highly effective inhibitor that belongs to the family of neutralizing antibodies. It is widely used in Life Sciences for various applications, including immunogenic compositions and assays. This antibody has been proven to effectively target the spike protein of the SARS-CoV-2 virus, which plays a crucial role in viral entry into host cells. By binding to the spike protein, this antibody prevents viral attachment and fusion, thereby inhibiting viral replication and spread.</p>HDAC5 antibody
<p>The HDAC5 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. This antibody specifically targets and binds to HDAC5, which stands for Histone Deacetylase 5. HDAC5 is an enzyme involved in the regulation of gene expression by modifying histones, which are proteins that help package DNA in cells. By binding to HDAC5, this antibody can modulate its activity and potentially impact various cellular processes.</p>SOX17 antibody
<p>The SOX17 antibody is a monoclonal antibody that specifically targets glucagon, a hormone involved in regulating blood sugar levels. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications. It can be used to detect and measure glucagon levels in human serum, making it a valuable tool for research and diagnostic purposes. Additionally, the SOX17 antibody has been found to have cytotoxic effects on certain cancer cells, making it a potential candidate for targeted therapy. Its high specificity and affinity for glucagon make it an ideal choice for experiments involving the detection and manipulation of this hormone. Whether you are studying the role of glucagon in diabetes or investigating its interaction with other molecules such as insulin or collagen, the SOX17 antibody is an indispensable tool that will provide reliable and accurate results.</p>TFEB antibody
<p>The TFEB antibody is a highly specialized product in the field of Life Sciences. It is designed to specifically bind to the TFEB receptor, which plays a crucial role in various cellular processes such as glucagon signaling and collagen synthesis. This antibody is widely used in research laboratories for studying the function and regulation of TFEB.</p>CD18 antibody
<p>CD18 antibody was raised in mouse using leucocytes from LGL-type leukemia as the immunogen.</p>NFkB p65 antibody
<p>The NFkB p65 antibody is a polyclonal antibody that is used for various applications in the field of Life Sciences. It is specifically designed to target and neutralize the NFkB p65 protein, which plays a crucial role in cellular signaling pathways. This antibody can be used for techniques such as hybridization, immunoprecipitation, and immunofluorescence.</p>BAFF antibody
<p>The BAFF antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that specifically targets and neutralizes the activity of BAFF (B-cell activating factor), a protein involved in the activation and survival of B-cells. This antibody has been extensively tested and proven to be effective in blocking the activity of BAFF, thereby preventing the proliferation and differentiation of B-cells.</p>ALOX15B antibody
<p>ALOX15B antibody was raised using the C terminal of ALOX15B corresponding to a region with amino acids ATCEGFIATLPPVNATCDVILALWLLSKEPGDQRPLGTYPDEHFTEEAPR</p>C2ORF29 antibody
<p>C2ORF29 antibody was raised using the middle region of C2Orf29 corresponding to a region with amino acids SVDISGLQLALAERQSELPTQSKASFPSILSDPDPDSSNSGFDSSVASQI</p>GPC5 antibody
<p>The GPC5 antibody is a highly specialized Polyclonal Antibody that targets the lipoprotein lipase, an enzyme involved in lipid metabolism. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications. It specifically binds to GPC5, a growth factor that plays a crucial role in adipose tissue development and function.</p>IL1b antibody
<p>The IL1b antibody is a monoclonal antibody that specifically targets IL-1β, a pro-inflammatory cytokine involved in various immune and inflammatory responses. This antibody binds to IL-1β and prevents its interaction with its receptors, thereby inhibiting the downstream signaling pathways that lead to inflammation.</p>Rabbit anti Mouse IgG3 (HRP)
<p>Rabbit anti-mouse IgG3 (HRP) was raised in rabbit using murine IgG3 heavy chain as the immunogen.</p>RNF121 antibody
<p>RNF121 antibody was raised using the N terminal of RNF121 corresponding to a region with amino acids WWRFLVIWILFSAVTAFVTFRATRKPLVQTTPRLVYKWFLLIYKISYATG</p>CARS antibody
<p>CARS antibody was raised using the C terminal of CARS corresponding to a region with amino acids KRKKKEEAARRKQEQEAAKLAKMKIPPSEMFLSETDKYSKFDENGLPTHD</p>CD40 antibody
<p>The CD40 antibody is a monoclonal antibody that plays a crucial role in the field of Life Sciences. It is used in various immunoassays to detect the presence of CD40, a protein that is involved in immune responses. This antibody specifically targets CD40 and binds to it, allowing for accurate detection and quantification. The CD40 antibody has been extensively studied and proven to be highly effective in detecting CD40 in human serum samples. Additionally, it has shown promising results in inhibiting the activity of specific enzymes, such as phosphatases and fatty acids, which are involved in various cellular processes. Furthermore, this antibody has demonstrated antiviral properties by interfering with viral replication and inhibiting the growth of viruses. Overall, the CD40 antibody is a valuable tool for researchers and scientists working in the field of immunology and virology.</p>PBEF1 antibody
<p>PBEF1 antibody was raised using the C terminal of PBEF1 corresponding to a region with amino acids VTLEEGKGDLEEYGQDLLHTVFKNGKVTKSYSFDEIRKNAQLNIELEAAH</p>Calretinin antibody
<p>The Calretinin antibody is a highly specialized monoclonal antibody that is used in the field of Life Sciences. It is designed to target and detect the presence of calretinin, a calcium-binding protein found in various tissues and cells. This antibody has been extensively tested and validated for its specificity and sensitivity.</p>HIPK4 antibody
<p>The HIPK4 antibody is a polyclonal antibody that specifically targets the protein complex known as homeodomain-interacting protein kinase 4 (HIPK4). This antibody is widely used in various life sciences research applications, including the study of glycosylation, growth factors, and biomolecules. It has been shown to be effective in detecting and quantifying HIPK4 levels in different cell types and tissues.</p>SRP19 antibody
<p>SRP19 antibody was raised using the middle region of SRP19 corresponding to a region with amino acids LCLVQFPSRKSVMLYAAEMIPKLKTRTQKTGGADQSLQQGEGSKKGKGKK</p>p70 S6 Kinase antibody
<p>The p70 S6 Kinase antibody is a highly specific monoclonal antibody used in Life Sciences research. It is designed to detect and target the p70 S6 Kinase protein, which plays a crucial role in various cellular processes, including cell growth and proliferation. This antibody recognizes the histidine-tagged form of the protein and can be used for applications such as Western blotting, immunoprecipitation, and immunofluorescence.</p>C20ORF20 antibody
<p>C20ORF20 antibody was raised using the N terminal Of C20Orf20 corresponding to a region with amino acids MGEAEVGGGGAAGDKGPGEAATSPAEETVVWSPEVEVCLFHAMLGHKPVG</p>
