Primary Antibodies

<p>Rabbit polyclonal Rad51D antibody</p>

<p>NAT10 antibody was raised in Rabbit using Human NAT10 as the immunogen</p>

<p>Cytokeratin 13 antibody was raised in mouse using cytokeratin 13 purified from human esophagus as the immunogen.</p>

<p>Purified Polyclonal Gamma enolase antibody</p>

<p>GTPBP2 antibody was raised in Rabbit using Human GTPBP2 as the immunogen</p>

<p>KCNJ4 antibody was raised using the middle region of KCNJ4 corresponding to a region with amino acids AVAAGLGLEAGSKEEAGIIRMLEFGSHLDLERMQASLPLDNISYRRESAI</p>

<p>The Tyrosine Hydroxylase antibody is a powerful tool for researchers in the field of Life Sciences. This monoclonal antibody is specifically designed to neutralize the activity of Tyrosine Hydroxylase, an enzyme involved in the synthesis of neurotransmitters like dopamine and norepinephrine. By targeting and inhibiting Tyrosine Hydroxylase, this antibody allows researchers to study the role of this enzyme in various biological processes.</p>

<p>The MMP7 antibody is a highly specialized monoclonal antibody that targets matrix metalloproteinase 7 (MMP7), an enzyme involved in the breakdown of extracellular matrix components. This antibody is widely used in Life Sciences research to study various cellular processes, including cell migration, tissue remodeling, and cancer progression.</p>

<p>DNALI1 antibody was raised using the C terminal of DNALI1 corresponding to a region with amino acids ALQAEQGKSDMERKIAELETEKRDLERQVNEQKAKCEATEKRESERRQVE</p>

<p>Purified Polyclonal GAD1/2 antibody</p>

<p>Influenza A antibody (H1N1) (FITC) was raised in goat using Influenza A, strain USSR (H1N1) as the immunogen.</p>

<p>EI24 antibody was raised in Rabbit using Human EI24 as the immunogen</p>

<p>Purified Rabbit polyclonal MYB28 antibody</p>

<p>Armenian Hamster monoclonal CD29 antibody (biotin)</p>

<p>GRIPAP1 antibody was raised in Rabbit using Human GRIPAP1 as the immunogen</p>

<p>Akt, or Protein Kinase B (PKB), is a crucial signaling protein that regulates essential cellular functions, including growth, survival, metabolism, and proliferation. It functions within the PI3K/Akt pathway, a key signaling pathway activated by growth factors and hormones like insulin to support cell survival and growth. Upon activation, Akt moves to the cell membrane, where it is phosphorylated by kinases such as PDK1, achieving full activation. Once active, Akt interacts with downstream pathways to prevent apoptosis, stimulate cell growth via the mTOR pathway, and boost glucose metabolism—vital for effective insulin response.In diseases like cancer and diabetes, Akt's role is especially important. Cancer often involves dysregulated Akt signaling due to mutations in pathway components like PI3K, PTEN, or Akt itself, leading to enhanced cell survival, unchecked growth, and treatment resistance. In diabetes, insulin resistance impairs Akt pathway function, reducing glucose uptake and resulting in high blood glucose levels. Given Akt's regulatory role in cell growth and metabolism, it is a primary focus in therapeutic research for conditions where its function is disrupted.</p>

<p>Affinity purified Rabbit polyclonal GULP1 antibody</p>

<p>Rabbit polyclonal GAB2 antibody (Tyr452)</p>

<p>EIF2S2 antibody was raised using the N terminal of EIF2S2 corresponding to a region with amino acids TQTEETQPSETKEVEPEPTEDKDLEADEEDTRKKDASDDLDDLNFFNQKK</p>

<p>PYK2 antibody was raised in Mouse using a purified recombinant fragment of PYK2(aa815-997) expressed in E. coli as the immunogen.</p>

<p>Affinity purified Rabbit polyclonal UBE2B antibody</p>

<p>ATP2C1 antibody was raised in Rabbit using Human ATP2C1 as the immunogen</p>

<p>The KLK6 antibody is an extracellular antibody that is primarily used in neuronal cultures for research purposes. This antibody specifically targets the phosphorylation site of KLK6, a protein that plays a crucial role in various biological processes within the Life Sciences field. KLK6 is known to interact with growth factors and synaptic proteins, and its activity has been linked to exocytosis and vesicular trafficking. By targeting KLK6, this polyclonal antibody can help researchers gain insights into the mechanisms of inhibitory neurotransmission and the regulation of protein isoforms. Additionally, it can be used to study the involvement of KLK6 in protein kinase signaling pathways.</p>

<p>The VAV1 antibody is a highly reactive and ultrasensitive detection tool used in Life Sciences research. This monoclonal antibody is specifically designed to target VAV1, a protein involved in various cellular processes such as growth factor signaling and immune response. The VAV1 antibody utilizes streptavidin-coated microspheres for efficient immobilization and detection, ensuring accurate and reliable results. Whether used in intraocular studies or on an electrode platform, this antibody provides exceptional sensitivity and specificity. Its versatility makes it an indispensable tool for researchers working with VAV1 and related pathways. Trust the VAV1 antibody to deliver precise and reproducible data in your experiments.</p>

<p>The JNK1 antibody is a highly specific monoclonal antibody that targets the JNK1 protein. It has been extensively tested and validated for use in various applications, including Western blotting, immunohistochemistry, and ELISA. This antibody has shown excellent performance in detecting JNK1 expression in human hepatocytes and other cell types.</p>

<p>ARL8B antibody was raised using the middle region of ARL8B corresponding to a region with amino acids DIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQL</p>

<p>Purified Rabbit polyclonal MYOM1 antibody</p>

<p>Nidogen/Enactin Monoclonal Antibody</p>

<p>The POSTN antibody is a highly specialized antibody that targets epidermal growth factor (EGF) and inhibitory factors in Life Sciences. This antibody is available in both polyclonal and monoclonal forms, offering versatility in research applications.</p>

<p>CD4 antibody (Azide Free) was raised in rat using cloned murine CTL line V41 as the immunogen.</p>

<p>Keratin K18 antibody was raised in Mouse using a purified recombinant fragment of human Keratin K18 (aa391-483) expressed in E. coli as the immunogen.</p>

<p>Mouse monoclonal PVRL1 antibody</p>

<p>Mouse monoclonal Complement C5b9 antibody (Biotin)</p>

<p>Rabbit polyclonal RFFL antibody</p>

<p>Mouse monoclonal VSIG2 antibody</p>

<p>HBsAg antibody (FITC) was raised in rabbit using subtypes ad &amp; ay as the immunogen.</p>

<p>LYPLA1 antibody was raised in Rabbit using Human LYPLA1 as the immunogen</p>

<p>NT5E antibody was raised in Mouse using a purified recombinant fragment of NT5E expressed in E. coli as the immunogen.</p>

<p>MOV10 antibody was raised using a synthetic peptide corresponding to a region with amino acids AKLDLQQGQNLLQGLSKLSPSTSGPHSHDYLPQEREGEGGLSLQVEPEWR</p>

<p>Purified Rabbit polyclonal OR2B2 antibody</p>

<p>Purified Rabbit polyclonal GNG5 antibody</p>

<p>The Calcitonin antibody is a highly specialized antibody used in the field of Life Sciences. It can be either polyclonal or monoclonal and is specifically designed to target calcitonin, a hormone involved in calcium regulation. This antibody has been extensively used in various assays and research studies to understand the role of calcitonin in different biological processes.</p>

<p>Rabbit Polyclonal ALK antibody (Tyr1586)</p>

<p>HSPA4 antibody was raised using the N terminal of HSPA4 corresponding to a region with amino acids PACISFGPKNRSIGAAAKSQVISNAKNTVQGFKRFHGRAFSDPFVEAEKS</p>

<p>Rabbit polyclonal XIRP2 antibody</p>

<p>FAM84B antibody was raised in Rabbit using Human FAM84B as the immunogen</p>

<p>The RPS9 antibody is a highly specialized polyclonal antibody that targets specific proteins in the body. It can be used for various applications, including research, diagnostics, and therapeutic purposes. This antibody specifically binds to tumor necrosis factor-alpha (TNF-α), a protein involved in inflammatory processes. By targeting TNF-α, the RPS9 antibody can potentially inhibit its activity and provide relief from inflammatory conditions.</p>

<p>The SH2B3 antibody is a highly specialized monoclonal antibody that is used in the field of Life Sciences. It is specifically designed to target and neutralize influenza hemagglutinin, a virus surface antigen responsible for the infection and spread of the influenza virus. This antibody is produced by a hybridoma cell line, ensuring its high specificity and potency.</p>

<p>The TMOD1 antibody is a highly specific monoclonal antibody that targets the glycoprotein TMOD1. This antibody has been shown to neutralize the superoxide produced by TMOD1 dimers, making it an essential tool for researchers studying the role of TMOD1 in various biological processes. The TMOD1 antibody can be used in a wide range of applications, including immunofluorescence, western blotting, and ELISA. It has also been used to study the effects of TMOD1 on interferon signaling and the development of autoimmune diseases. With its high specificity and cytotoxic properties, the TMOD1 antibody is a valuable tool for researchers in the Life Sciences field.</p>

<p>The RhoA antibody is a powerful tool used in Life Sciences research. It specifically targets RhoA, a small GTPase protein that plays a crucial role in various cellular processes. This monoclonal antibody has been extensively tested and validated for its specificity and sensitivity.</p>

<p>The GPR125 antibody is a diagnostic reagent used in the field of Life Sciences. It is a polyclonal antibody that specifically targets GPR125, which is a protein-coupled receptor involved in various cellular processes. This antibody is produced by antibody-secreting cells and can be used in immunocytochemical methods to detect the presence and localization of GPR125 in cells and tissues. It has been shown to have specific reactivity towards GPR125 and can be used for various applications such as flow cytometry analysis and polymerase chain reactions. Additionally, this antibody has opsonophagocytic activity, meaning it can enhance the process of phagocytosis by immune cells. Overall, the GPR125 antibody is a valuable tool for researchers studying inflammasome proteins and other related areas in Life Sciences.</p>

<p>AGGF1 antibody was raised using the middle region of AGGF1 corresponding to a region with amino acids EYEDEKTLKNPKYKDRAGKRREQVGSEGTFQRDDAPASVHSEITDSNKGR</p>

<p>HLCS antibody was raised in Rabbit using Human HLCS as the immunogen</p>

<p>Lamin A Monoclonal Antibody (HRP)</p>

<p>Purified Polyclonal SFTPA2 antibody</p>

<p>SILV antibody was raised using a synthetic peptide corresponding to a region with amino acids HFLRNQPLTFALQLHDPSGYLAEADLSYTWDFGDSSGTLISRALVVTHTY</p>

<p>Rabbit polyclonal RAR alpha antibody (Ser77)</p>

<p>RBMS3 antibody was raised using the N terminal of RBMS3 corresponding to a region with amino acids GVQAQMAKQQEQDPTNLYISNLPISMDEQELENMLKPFGHVISTRILRDA</p>

<p>The CD19 antibody is a highly effective and stable liquid formulation that belongs to the class of antibodies. It is designed to target and bind specifically to CD19, a cell surface antigen expressed on antibody-secreting cells. This monoclonal antibody has been widely used in the field of Life Sciences for various applications, including research, diagnostics, and therapeutics.</p>

<p>The CD117 antibody is a powerful tool used in the field of Life Sciences for various applications. It is specifically designed to target and bind to CD117, a protein that is expressed on the surface of endogenous hematopoietic cells. This antibody can be used in research to study the role of CD117 in cell signaling, proliferation, and differentiation.</p>

<p>The MZF1 antibody is a potent family kinase inhibitor that belongs to the class of antibodies. It specifically targets fibrinogen, a protein involved in blood clotting. This polyclonal antibody has been extensively studied and proven to be effective in inhibiting the activity of fibrinogen. It can be used in various applications in the field of Life Sciences, such as research on dopamine receptors and growth factors. Additionally, this monoclonal antibody has shown inhibitory effects on tyrosine kinases, which play a crucial role in cell signaling pathways. The MZF1 antibody is a valuable tool for scientists and researchers working in the fields of biology, medicine, and pharmacology. Its versatility and specificity make it an essential component in various experiments and studies.</p>

<p>Purified Polyclonal USP19 antibody</p>

<p>Purified Rabbit polyclonal MRC1 antibody</p>

<p>Recombinant hnRNP C1+C2 Monoclonal Antibody</p>

<p>The RBBP7 antibody is a monoclonal antibody used in Life Sciences research. It is commonly used to detect and study the protein RBBP7, which plays a crucial role in various cellular processes. This antibody specifically binds to RBBP7 and can be used for applications such as immunohistochemistry, western blotting, and flow cytometry.</p>

<p>C21orf58 antibody was raised using the N terminal of C21orf58 corresponding to a region with amino acids MARSRLPATSLRKPWKLDRQKLPSPDSGHSLLCGWSPGGKARPAGNTGAW</p>

<p>MTHFD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VILVGENPASHSYVLNKTRAAAVVGINSETIMKPASISEEELLNLINKLN</p>

<p>Purified Polyclonal PGRMC2 antibody</p>

<p>CSK antibody was raised using the middle region of CSK corresponding to a region with amino acids SEDNVAKVSDFGLTKEASSTQDTGKLPVKWTAPEALREKKFSTKSDVWSF</p>

<p>Mouse monoclonal PYCR2 antibody</p>

<p>Rabbit polyclonal RNF7 antibody</p>

<p>Affinity purified Rabbit polyclonal MAPK 8/9 antibody</p>

<p>EVI1 antibody was raised using the N terminal of EVI1 corresponding to a region with amino acids VKGLSSTEQTNKSQSPLMTHPQILPATQDILKALSKHPSVGDNKPVELQP</p>

<p>MGC48628 antibody was raised using the N terminal of MGC48628 corresponding to a region with amino acids HHKKGSEPKQEPTNQNLSISNGAQPGHSNMQKLSLEEHIKTRGRHSVGFS</p>

<p>Mouse monoclonal DNAJA2 antibody</p>

<p>Rabbit polyclonal Stathmin 1 antibody (Ser24)</p>

<p>The CD71 Antibody is a highly effective monoclonal antibody that has a wide range of applications in the field of biomedical research. This antibody specifically targets CD71, also known as transferrin receptor protein 1, which is expressed on the surface of cells and plays a crucial role in iron metabolism.</p>

<p>KLH antibody is a highly specialized antibody that specifically targets and binds to key proteins involved in various biological processes. It has been extensively studied in the field of Life Sciences and has shown promising results in different areas of research.</p>

<p>RPESP antibody was raised using the middle region of RPESP corresponding to a region with amino acids LRCSGDGLDSDGNQTLHWQAIGNPRCQGTWKKVRRVDQCSCPAVHSFIFI</p>

<p>Rabbit polyclonal CaMK2 beta/gamma/delta antibody (Thr287)</p>

<p>CYP2A6 antibody was raised in Rabbit using Human CYP2A6 as the immunogen</p>

<p>The MAP1 antibody is a highly specialized monoclonal antibody that targets the alpha-fetoprotein (AFP) and its associated growth factor. This antibody specifically binds to the tyrosine kinase receptor of AFP, inhibiting its activity and preventing further cellular growth and proliferation. The MAP1 antibody has been extensively tested using electrode techniques and has shown remarkable specificity and effectiveness in neutralizing AFP.</p>

<p>Mouse monoclonal RASSF1 antibody</p>

<p>Rabbit polyclonal ACBD6 antibody</p>

<p>Rabbit polyclonal GM2A antibody (biotin)</p>

<p>CPOX antibody was raised in Rabbit using Human CPOX as the immunogen</p>

<p>Mouse monoclonal Aeromonas caviae antibody</p>

<p>The Cathepsin B antibody is a highly effective monoclonal antibody that targets the cyclase-activating peptide (CAP). It is widely used in Life Sciences research to study various biological processes. This antibody has been shown to neutralize the activity of cathepsin B, an important enzyme involved in the degradation of fatty acids and collagen. The Cathepsin B antibody recognizes a conformational epitope on cathepsin B, making it highly specific for this target. In addition, this antibody can be used in combination with Polyclonal Antibodies to detect and quantify biomolecules in complex samples. The Cathepsin B antibody has also been found to have cytotoxic effects on certain cell types, making it a valuable tool for studying cell signaling pathways. Whether you are conducting basic research or developing new therapeutic strategies, the Cathepsin B antibody is an essential tool for your studies.</p>

<p>Affinity purified Rabbit polyclonal Fibrinogen gamma antibody</p>

<p>Rabbit polyclonal SPAG7 antibody</p>

<p>CLSTN1 antibody was raised in Rabbit using Human CLSTN1 as the immunogen</p>

<p>Mouse monoclonal PAICS antibody</p>

<p>Mouse monoclonal gamma Actin antibody</p>

<p>Mouse monoclonal HMOX2 antibody</p>

<p>MUC3B antibody was raised using the N terminal of MUC3B corresponding to a region with amino acids KSGYAFVDCPDEHWAMKAIETFSGKVELQGKRLEIEHSVPKKQRSRKIQI</p>

<p>The FOSB antibody is a highly specialized product in the field of Life Sciences. It is designed to target actin filaments that have been activated in various biological systems. This antibody has been extensively tested and proven to be effective in detecting the presence of actin filaments in human serum samples. Additionally, it has shown strong affinity for nuclear actin and has been used successfully in studies involving endothelial growth factors.</p>

<p>The Caveolin 1 antibody is a monoclonal antibody that is used for immunohistochemical detection. It specifically targets caveolin 1, a protein that plays a crucial role in various cellular processes. This antibody can be used to detect caveolin 1 in human serum, making it a valuable serum marker for diagnostic purposes.</p>

<p>Purified Polyclonal CSRNP2 antibody</p>

<p>Rabbit polyclonal GOT2 antibody (HRP)</p>

<p>RAB11FIP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLIQGSPEKYILFLIVMHRSLVGLDKFLGQVAINLNDIFEDKQRRKTEWF</p>