Primary Antibodies

<p>CUL2 antibody was raised in Rabbit using Human CUL2 as the immunogen</p>

<p>Rabbit polyclonal COL16A1 antibody</p>

<p>Human phos TIE2 (Tyr1108) immunogen, Rabbit Polyclonal TIE2 antibody</p>

<p>Rabbit polyclonal CLK1 antibody</p>

<p>Rabbit polyclonal HTR4 antibody</p>

<p>The Ephrin B1 antibody is a biomolecule that plays a crucial role in cell signaling and growth factor regulation. This antibody specifically targets the alpha-synuclein protein, which is associated with neurodegenerative diseases such as Parkinson's disease. By binding to alpha-synuclein, the Ephrin B1 antibody helps regulate its activity and prevent the formation of toxic aggregates.</p>

<p>PAPOLB antibody was raised using the N terminal of PAPOLB corresponding to a region with amino acids TDCLLTQRLIETLRPFGVFEEEEELQRRILVLEKLNNLVKEWIREISESK</p>

<p>Prohibitin 2 antibody was raised using the N terminal of PHB2 corresponding to a region with amino acids WFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQR</p>

<p>Rabbit polyclonal TERF1 antibody</p>

<p>C2ORF29 antibody was raised using the N terminal Of C2Orf29 corresponding to a region with amino acids NPFAASFAHLLNPAPPARGGQEPDRPPLSGFLPPITPPEKFFLSQLMLAP</p>

<p>Affinity purified Rabbit polyclonal HRH3 antibody</p>

<p>TBC1D25 antibody was raised using the N terminal of TBC1D25 corresponding to a region with amino acids KVQQVLSWSYGEDVKPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGG</p>

<p>CYTH1 antibody was raised in Rabbit using Human CYTH1 as the immunogen</p>

<p>The SCNN1A antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the enteroendocrine cells and interferon production. This antibody has been extensively studied for its glycosylation patterns and its ability to induce caspase-9 activation, leading to cell lysis. Additionally, it has shown neutralizing effects on cytotoxic growth factors and anti-DNP antibodies. The viscosity of this antibody solution is optimized for easy handling and storage. Whether you're conducting experiments or performing assays, the SCNN1A antibody is a valuable tool in your research arsenal.</p>

<p>Lipoprotein Lipase Monoclonal Antibody Biotin</p>

<p>The GAL1 antibody is a highly specialized antibody that targets hepatocyte growth and lipase activity. It belongs to the class of monoclonal antibodies in Life Sciences. This antibody specifically binds to lipoprotein lipase (LPL) and apoa-I, which are key players in lipid metabolism. By targeting these molecules, the GAL1 antibody can modulate lipid levels and potentially have an impact on cardiovascular health. Additionally, this antibody has shown potential as a growth factor for certain cell types, such as endothelial cells, through its interaction with the growth hormone receptor. The GAL1 antibody is available in both monoclonal and polyclonal forms, offering researchers different options for their specific needs.</p>

<p>Ubiquilin-Like antibody was raised using the middle region of UBQLNL corresponding to a region with amino acids LTQHPATRVIYNSSGGFSSNTSANDTLNKVNHTSKANTAMISTKGQSHIC</p>

<p>Purified Polyclonal Carbonic Anhydrase 5A antibody</p>

<p>SMU1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KQTQPERYIHLENLLARSYFDPREAYPDGSSKEKRRAAIAQALAGEVSVV</p>

<p>TRPM3 antibody was raised using the N terminal of TRPM3 corresponding to a region with amino acids ALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQD</p>

<p>SMPD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RQKLSPTYPAAHHFRSGIIGSGLCVFSKHPIQELTQHIYTLNGYPYMIHH</p>

<p>FAM117B antibody was raised in Rabbit using Human FAM117B as the immunogen</p>

<p>Antithrombin III antibody (biotin) was raised in sheep using human antithrombin purified from plasma as the immunogen.</p>

<p>Rabbit polyclonal Cyclin C antibody (Ser275)</p>

<p>Mouse monoclonal CP4 EPSPS antibody</p>

<p>The CDK2 antibody is a powerful tool in the field of Life Sciences. It is a cytotoxic antibody that specifically targets the CDK2 molecule, which plays a crucial role in cell cycle regulation and proliferation. This antibody can be used in various applications, including immunohistochemistry, western blotting, and flow cytometry.</p>

<p>EGFL7 antibody was raised in Rabbit using Human EGFL7 as the immunogen</p>

<p>The BTK antibody is a powerful tool in the field of Life Sciences. It targets the Bruton's tyrosine kinase (BTK), which plays a crucial role in various cellular processes. This antibody can be used for research purposes, such as studying the effects of BTK inhibition on cell signaling pathways and protein kinase activity.</p>

<p>ADARB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NMSSSSTDVKENRNLDNVSPKDGSTPGPGEGSQLSNGGGGGPGRKRPLEE</p>

<p>The CBP antibody is a highly effective inhibitor that targets nuclear proteins. It is a monoclonal antibody that specifically recognizes and binds to acetylated biomolecules. This antibody has been extensively studied and proven to be cytotoxic against various types of cells. In Life Sciences research, the CBP antibody is commonly used in reaction solutions for experiments involving brain natriuretic peptide (BNP) and other related growth factors. It is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs. The CBP antibody is supplied in buffered solutions, ensuring stability and maintaining its effectiveness throughout experiments.</p>

<p>RSRC2 antibody was raised using the C terminal of RSRC2 corresponding to a region with amino acids DQNVKFRKLMGIKSEDEAGCSSVDEESYKTLKQQEEVFRNLDAQYEMARS</p>

<p>The IL20R2 antibody is a monoclonal antibody that is used in immunoassays to detect and quantify IL20R2 protein levels in human serum. It has been shown to have high specificity and sensitivity, making it an ideal tool for researchers studying the role of IL20R2 in various biological processes. This antibody can be used for applications such as Western blotting, ELISA, and immunohistochemistry. The IL20R2 antibody has also been used in molecular docking studies to understand its interaction with other molecules, providing valuable insights into its mechanism of action. With its ultrasensitive detection capabilities, this antibody is a valuable asset in the field of life sciences research.</p>

<p>SLAIN1 antibody was raised using the middle region of SLAIN1 corresponding to a region with amino acids RSPSSQYFPSNNYQQQQYYSPQAQTPDQQPNRTNGDKLRRSMPNLARMPS</p>

<p>NDUFS8 antibody was raised in rabbit using the C terminal of NDUFS8 as the immunogen</p>

<p>HBeAg antibody was raised in mouse using purified HBeAg as the immunogen.</p>

<p>C4BPA antibody was raised in Rabbit using Human C4BPA as the immunogen</p>

<p>Rabbit polyclonal CCBP2 antibody</p>

<p>EVI1 antibody was raised in mouse using recombinant Human Ecotropic Viral Integration Site 1 (Evi1)</p>

<p>ARD1A antibody was raised using a synthetic peptide corresponding to a region with amino acids VESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSE</p>

<p>Rabbit polyclonal PPIL6 antibody</p>

<p>CAMLG antibody was raised using the N terminal of CAMLG corresponding to a region with amino acids LLMNSEQRINRIMGFHRPGSGAEEESQTKSKQQDSDKLNSLSVPSVSKRV</p>

<p>Rabbit polyclonal ARRD4 antibody</p>

<p>Rabbit polyclonal REPS2 antibody</p>

<p>Mouse monoclonal ANAPC2 antibody</p>

<p>TDRD9 antibody was raised using the middle region of TDRD9 corresponding to a region with amino acids AINIRDVLIQQGYAELTEESYESKQSHEVLKGLFSKSVENMTDGSVPFPM</p>

<p>CD8a antibody was raised in rat using murine thymus or spleen as the immunogen.</p>

<p>EPHB6 antibody was raised in Mouse using a purified recombinant fragment of EPHB6 expressed in E. coli as the immunogen.</p>

<p>ICAM2 antibody is a growth factor that plays a crucial role in various cellular processes. It has been shown to be involved in the regulation of immune responses, cell adhesion, and signal transduction. This antibody specifically targets ICAM2, an antigen expressed on the surface of cells.</p>

<p>Rabbit polyclonal PEK antibody (Thr981)</p>

<p>TNNI3K antibody was raised using the middle region of TNNI3K corresponding to a region with amino acids PGRSHVAALRSRFELEYALNARSYAALSQSAGQYSSQGLSLEEMKRSLQY</p>

<p>C5ORF36 antibody was raised using the N terminal Of C5Orf36 corresponding to a region with amino acids CFEWLTNYNYSTSESSFISHGDLIKFFKTLQDLLKNEQNQEEMTLDLLWD</p>

<p>Sheep RBC antibody (FITC) was raised in rabbit using ovine erythrocytes as the immunogen.</p>

<p>The BRDU antibody is a growth factor that belongs to the class of glycoproteins. It acts by binding to specific proteins and promoting cell growth and division. This monoclonal antibody is highly specific and targets activated cells, making it a valuable tool in cancer research and diagnostics. The BRDU antibody can be used in various applications, including immunohistochemistry, flow cytometry, and western blotting. It is also cytotoxic, meaning it can selectively kill cells expressing the target protein. Additionally, this antibody has shown potential as an inhibitor of transmembrane conductance and has been implicated in the regulation of autoantibodies and chemokines. With its high specificity and versatility, the BRDU antibody is an essential tool for researchers studying cell growth and signaling pathways.</p>

<p>The AFP antibody is a monoclonal antibody that specifically targets alpha-fetoprotein (AFP), a growth factor found in adipose tissue. This antibody is widely used in life sciences research and has various applications in the field. It can be used as an inhibitor to study the function of AFP or as a tool to detect and measure AFP levels in biological samples.</p>

<p>The CR4 antibody is a highly specialized monoclonal antibody that targets cholinergic growth factors, specifically choline acetyltransferase. It has been extensively studied in the field of Life Sciences and has shown promising results in various applications.</p>

<p>Mouse monoclonal TTLL12 antibody</p>

<p>Rabbit polyclonal GRIN2C antibody (Ser1096)</p>

<p>Rabbit polyclonal DLGAP5 antibody</p>

<p>Rabbit polyclonal PECR antibody</p>

<p>Rabbit polyclonal ATF2 antibody (Ser480)</p>

<p>The HBsAg antibody is a monoclonal antibody that specifically targets the alpha-fetoprotein (AFP) in human serum. This antibody has been activated to enhance its binding affinity and effectiveness. It is commonly used in life sciences research, particularly in studies related to the detection and quantification of AFP levels. The HBsAg antibody can be utilized in various applications such as immunoassays, western blotting, and immunohistochemistry. Its high specificity ensures accurate and reliable results. Additionally, this antibody has been engineered to have low cross-reactivity with other molecules, ensuring minimal interference from potential inhibitors or colloidal substances. With its exceptional performance and reliability, the HBsAg antibody is an essential tool for researchers in the field of Life Sciences.</p>

<p>HERC6 antibody was raised using the N terminal of HERC6 corresponding to a region with amino acids LSKDSQVFSWGKNSHGQLGLGKEFPSQASPQRVRSLEGIPLAQVAAGGAH</p>

<p>Purified Polyclonal DGK beta antibody</p>

<p>Rabbit polyclonal RAB43 antibody</p>

<p>Rabbit polyclonal DDX39B antibody (FITC)</p>

<p>Rabbit polyclonal NFKB1 antibody (FITC)</p>

<p>The PON1 antibody is a monoclonal antibody that has the ability to neutralize the activity of paraoxonase 1 (PON1). PON1 is an enzyme that plays a crucial role in protecting against oxidative stress and inflammation. By binding to PON1, this antibody can inhibit its activity and prevent the harmful effects associated with oxidative stress.</p>

<p>The p63 antibody is a highly specialized antibody used in the field of Life Sciences. It is a nuclear antibody that reacts specifically with p63 protein, an essential regulator of cell growth and development. This polyclonal antibody is designed to recognize and bind to the activated form of p63 in various biological samples.</p>

<p>Purified Polyclonal ST3N antibody</p>

<p>Rabbit polyclonal EGF antibody (FITC)</p>

<p>KMO antibody was raised in Rabbit using Human KMO as the immunogen</p>

<p>The HPX antibody is a neutralizing antibody that targets interferon and autoantibodies. It has been shown to have a high affinity for hemoglobin and growth factors. This polyclonal antibody is capable of binding to various proteins, including alpha-fetoprotein, c-myc, telomerase, collagen, and fibronectin. The HPX antibody can form complexes with these proteins, leading to their neutralization and inhibition of their biological activities. This antibody is widely used in research and diagnostic applications for its ability to detect and quantify specific proteins in various samples. Its versatility and specificity make it an essential tool for studying protein-protein interactions and understanding the role of specific proteins in various biological processes.</p>

<p>DOC2B antibody was raised in Rabbit using Human DOC2B as the immunogen</p>

<p>The RARG antibody is a monoclonal antibody that targets the retinoic acid receptor gamma (RARG). It acts as a growth factor and has been shown to inhibit hepatocyte growth. This antibody can be used for various applications, including research and therapeutic purposes. It has been found to have cytotoxic effects on cancer cells, such as MCF-7, and can also enhance the efficacy of other anticancer drugs. The RARG antibody binds specifically to RARG and modulates its activity, affecting downstream signaling pathways involved in cell proliferation, differentiation, and apoptosis. It has also been shown to interact with other proteins, such as fibronectin and lipoprotein lipase. This versatile antibody is a valuable tool for studying the role of RARG in various biological processes and may have potential applications in cancer treatment.</p>

<p>The CYB5R3 antibody is a polyclonal antibody that plays a crucial role in various cholinergic and growth factor-related processes in Life Sciences. It is commonly used in research to study the cytotoxic effects of certain compounds on liver microsomes and dopamine metabolism. The CYB5R3 antibody specifically targets and binds to activated CYB5R3, an enzyme involved in electron transfer reactions. This binding inhibits the enzymatic activity of CYB5R3, leading to a decrease in the production of reactive oxygen species and neuroprotective effects. Additionally, this antibody has been shown to inhibit the expression of interleukin-6, a pro-inflammatory cytokine. The CYB5R3 antibody is produced by a hybridoma cell line, ensuring its high specificity and quality. Researchers can use this antibody as a valuable tool for studying the role of CYB5R3 in various biological processes and developing potential inhibitors for therapeutic applications.</p>

<p>Rabbit polyclonal PSMB2 antibody</p>

<p>Mouse monoclonal COBRA1 antibody</p>

<p>ITPK1 antibody was raised using the N terminal of ITPK1 corresponding to a region with amino acids MEVVQLNLSRPIEEQGPLDVIIHKLTDVILEADQNDSQSLELVHRFQEYI</p>

<p>The Ractopamine antibody is a specific monoclonal antibody that has been developed for research purposes in the field of Life Sciences. This antibody has high affinity and specificity for Ractopamine, making it an ideal tool for detecting and quantifying this compound in various samples. It can be used in various immunoassays such as ELISA, Western blotting, and immunohistochemistry.</p>

<p>Rabbit polyclonal TLP1 antibody</p>

<p>NEK7 antibody was raised using a synthetic peptide corresponding to a region with amino acids KARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMI</p>

<p>The IRS1 antibody is a monoclonal antibody that specifically targets insulin receptor substrate 1 (IRS1). This antibody plays a crucial role in regulating insulin signaling pathways and has been widely used in various studies related to diabetes, obesity, and metabolic disorders.</p>

<p>The P21 antibody is a highly specialized polyclonal antibody that is used in various fields of life sciences. It has a high viscosity, which allows for efficient binding to target molecules. This antibody is particularly effective in neutralizing tumor necrosis factor-alpha (TNF-α), interleukin-6, interferon, and other growth factors. Its monoclonal nature ensures a specific antigen-antibody reaction, making it suitable for various applications such as immunohistochemistry, Western blotting, and enzyme-linked immunosorbent assays (ELISA). Additionally, the P21 antibody can be used to detect virus surface antigens and has shown promising results as an anti-MERTK antibody. With its versatility and reliability, this antibody is an essential tool for researchers and scientists in the field of life sciences.</p>

<p>Purified Rabbit polyclonal p70S6K antibody (Ser418)</p>

<p>LYSMD2 antibody was raised using the middle region of LYSMD2 corresponding to a region with amino acids VEHRVRAGDTLQGIALKYGVTMEQIKRANKLFTNDCIFLKKTLNIPVISE</p>

<p>Mouse monoclonal TBXAS1 antibody</p>

<p>The Cyclin A antibody is a highly specialized and potent phosphatase inhibitor that is widely used in industrial applications. It is a monoclonal antibody that specifically targets and binds to activated Cyclin A, preventing its interaction with protein kinases and inhibiting cell division. This antibody has shown great potential as an antidiabetic medicament, as it exhibits inhibitory effects on key enzymes involved in glucose metabolism. In addition, the Cyclin A antibody has been extensively studied in the field of Life Sciences, where it has been used for molecular docking and molecular modeling experiments. Its high affinity and specificity make it an invaluable tool for researchers in various scientific disciplines.</p>

<p>The CD91 antibody is a highly versatile product in the field of Life Sciences. It has been extensively used in various applications such as 2-deoxyglucose assays, dermal fibroblasts studies, and antibody-based assays. This antibody has shown promising results in anti-thrombotic research and has been found to play a crucial role in ferroptosis regulation. Furthermore, it has been observed to act as a secretagogue in neuroendocrine cells and exhibit strong binding affinity towards dermal binding proteins like hsp90α. The CD91 antibody is also known for its excellent staining capabilities and its ability to interact with glucose transporters. With its wide range of applications and impressive performance, this antibody is an essential tool for researchers in the field of Life Sciences.</p>

<p>Purified Rabbit polyclonal Chk1 antibody (Ser296)</p>

<p>The MVP antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to dinitrophenyl (DNP) antigens, making it a valuable tool for studying immune responses. This antibody has been shown to have neutralizing effects on interferon and endothelial growth factors, inhibiting their activity. Additionally, the MVP antibody has been found to induce lysis of target cells in the presence of complement or human serum. Its ability to inhibit caspase-9 activation suggests a potential role in apoptosis regulation. Furthermore, this monoclonal antibody has been shown to immobilize β-catenin, an important protein involved in cell adhesion and signaling pathways. These unique characteristics make the MVP antibody an essential tool for researchers studying antiangiogenic and growth factor-related processes in various biological systems.</p>

<p>Rabbit Polyclonal p44/42 MAP Kinase antibody (Thr202)</p>

<p>Mouse monoclonal TMEM100 antibody</p>

<p>The ApoE antibody is a monoclonal antibody that is widely used in the field of Life Sciences. It specifically targets apolipoprotein E, a protein involved in the transport and metabolism of fatty acids. This antibody has been extensively studied and shown to have various applications.</p>

<p>Rabbit polyclonal KAP0 antibody</p>

<p>DPYSL5 antibody was raised in Rabbit using Human DPYSL5 as the immunogen</p>

<p>The EPHB3 antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that specifically targets the epidermal growth factor receptor EPHB3. This antibody is widely used in research to study the role of this growth factor in various biological processes.</p>

<p>Troponin I Type 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PLHIPGSMSEVQELCKQLHAKIDAAEEEKYDMEVRVQKTSKELEDMNQKL</p>

<p>CRELD1 antibody was raised using the C terminal of CRELD1 corresponding to a region with amino acids TEVCPGENKQCENTEGGYRCICAEGYKQMEGICVKEQIPESAGFFSEMTE</p>

<p>IL1RN antibody was raised in Rabbit using Human IL1RN as the immunogen</p>

<p>The CD11a antibody is a monoclonal antibody that specifically targets the CD11a protein, which is found in human serum. This antibody has been extensively studied and shown to have high affinity and specificity for CD11a. It has been used in various research applications, including the study of autoimmune diseases such as diabetes and rheumatoid arthritis.</p>