Primary Antibodies

<p>Rabbit polyclonal STRBP antibody</p>

<p>The IFN gamma antibody is a monoclonal antibody that targets interferon gamma, a cytokine involved in immune response regulation. This antibody specifically binds to interferon gamma and neutralizes its activity, making it an effective tool for research in the field of immunology. The IFN gamma antibody has been widely used in various life science applications, including ELISA, Western blotting, flow cytometry, and immunohistochemistry. It can be conjugated with different labels such as biotin or fluorescent dyes for detection purposes. Researchers rely on this antibody to study the role of interferon gamma in various diseases and to develop potential therapeutic strategies targeting this cytokine.</p>

<p>The TS antibody is an autoantibody that specifically targets glial fibrillary acidic protein (GFAP), a protein found in the central nervous system. It is commonly used in life sciences research to study the role of GFAP in various cellular processes. The TS antibody recognizes specific epitopes on GFAP and can be used for immunohistochemistry, immunocytochemistry, and Western blotting applications. This monoclonal antibody has high specificity and sensitivity, making it a valuable tool for studying GFAP expression and function. Additionally, the TS antibody can be conjugated with different fluorophores or enzymes for multiplexing experiments or detection purposes. Whether you're researching neurodegenerative diseases or investigating cellular responses to growth factors, the TS antibody is an essential reagent for your experiments. Trust its reliability and performance to deliver accurate and reproducible results in your scientific endeavors.</p>

<p>ADH6 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGAARIIGVDVNKEKFKKAQELGATECLNPQDLKKPIQEVLFDMTDAGID</p>

<p>The GAPDH antibody is a highly effective polyclonal antibody that is capable of neutralizing the activity of glyceraldehyde-3-phosphate dehydrogenase (GAPDH). This antibody has been extensively tested and shown to effectively inhibit the function of GAPDH in various experimental settings.</p>

<p>Mouse monoclonal CD123 antibody (biotin)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its efficacy has been proven through extensive testing using the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and effectively inhibits their growth in</p>

<p>Mouse monoclonal FCGR2A antibody</p>

<p>Rabbit Polyclonal Her3 antibody (Tyr1328)</p>

<p>Mouse monoclonal SHPRH antibody</p>

<p>The PGAM1 antibody is a highly versatile and potent tool used in various industries, including Life Sciences and industrial applications. This antibody exhibits antioxidant activity and has been shown to have an inhibitory effect on the growth factor. It can be immobilized for use in various assays, making it an essential component in molecular biology research.</p>

<p>Insulin/proinsulin antibody was raised in mouse using purified mouse Insulin and proinsulin as the immunogen.</p>

<p>The Cyclin A antibody is a polyclonal antibody that is used in Life Sciences research. It specifically targets cyclin A, a protein involved in cell cycle regulation. This antibody can be used to study the role of cyclin A in various cellular processes, including DNA replication and cell division. Additionally, it has been shown to have potential applications in the detection of insulin-like autoantibodies and alpha-synuclein antigen. The Cyclin A antibody is highly specific and sensitive, making it a valuable tool for researchers studying hormone peptides, growth factors, and virus surface antigens. With its ability to detect activated proteins, this antibody is essential for understanding the complex mechanisms of cellular signaling pathways.</p>

<p>Rabbit polyclonal ZIC1/2/3/4/5 antibody</p>

<p>Rabbit polyclonal PLEKHA9 antibody</p>

<p>Affinity purified Rabbit polyclonal FGF22 antibody</p>

<p>DPT antibody was raised in Rabbit using Human DPT as the immunogen</p>

<p>AKT2 antibody was raised in Mouse using a purified recombinant fragment of human Akt2 expressed in E. coli as the immunogen.</p>

<p>Rabbit polyclonal TRMT2B antibody</p>

<p>Purified Polyclonal CLCC1 antibody</p>

<p>Rabbit Polyclonal FKHR antibody (Ser319)</p>

<p>Rabbit polyclonal UBE2E2 antibody</p>

<p>The RhoA antibody is a powerful tool in the field of Life Sciences. It is a highly specific antibody that targets RhoA, a small GTPase protein involved in various cellular processes. This antibody can be used in both research and clinical settings to study the role of RhoA in different biological pathways.</p>

<p>Salmonella antibody was raised in mouse using flagellum protein present in most Salmonella species as the immunogen.</p>

<p>The Claudin 7 antibody is a highly effective monoclonal antibody that targets the glycoprotein Claudin 7. It has anti-VEGF (vascular endothelial growth factor) properties and can inhibit the activity of epidermal growth factor. This antibody is widely used in Life Sciences research, particularly in studies related to antibodies, monoclonal antibodies, and polyclonal antibodies. The Claudin 7 antibody has been extensively characterized and is known for its high specificity and affinity for its target. It can be used in various applications such as immunohistochemistry, Western blotting, ELISA, and flow cytometry. With its unique properties and versatility, the Claudin 7 antibody is an essential tool for scientists working in the field of molecular biology and cellular research.</p>

<p>The PNMT antibody is an extracellular antigen that plays a crucial role in reductive processes. It can be used in various applications, including adeno-associated virus research and the development of therapeutic antibodies. The PNMT antibody is a highly specific monoclonal antibody that targets the activated form of the PNMT protein complex. It has been extensively tested and shown to have neutralizing properties against multidrug-resistant strains. This antibody is widely used in the life sciences field for its ability to detect and study low-density protein complexes. With its high specificity and soluble nature, the PNMT antibody is an invaluable tool for researchers in need of reliable and accurate detection methods.</p>

<p>Rabbit polyclonal PDIA3 antibody (FITC)</p>

<p>NRIP1 antibody was raised in mouse using recombinant Human Nuclear Receptor Interacting Protein 1 (Nrip1)</p>

<p>GEMIN6 antibody was raised in Rabbit using Human GEMIN6 as the immunogen</p>

<p>Rabbit polyclonal THRB antibody</p>

<p>Rabbit polyclonal GPR25 antibody</p>

<p>Mouse monoclonal MAPK8 antibody</p>

<p>The SCGF antibody is a peptide agent that belongs to the globulin class of proteins. It is widely used in Life Sciences research as a growth factor and basic protein. This antibody acts as an anticoagulant and can be used in various applications such as immunoassays, western blotting, and immunohistochemistry. The SCGF antibody can also be conjugated with streptavidin for enhanced detection or used in combination with monoclonal antibodies for neutralizing specific targets. Additionally, this antibody has been shown to have catalase activity, making it useful for studying oxidative stress and antioxidant mechanisms in human serum. With its versatility and high specificity, the SCGF antibody is an invaluable tool for researchers in a wide range of fields.</p>

<p>Rabbit polyclonal PFD5 antibody (biotin)</p>

<p>Purified Rabbit polyclonal ERF antibody (Thr526)</p>

<p>The eIF2 alpha antibody is a polyclonal antibody used in Life Sciences research. It specifically targets and binds to eIF2 alpha, a protein involved in the regulation of translation initiation. This antibody is commonly used in studies related to insulin signaling, as well as in the development of therapeutic antibodies like trastuzumab and metoclopramide. In addition, it can be used as a tool for detecting eIF2 alpha autoantibodies or as a marker for identifying cells expressing high levels of this protein. The eIF2 alpha antibody has been proven to be highly specific and sensitive, making it an essential component in various research applications.</p>

<p>The PKR antibody is a highly effective tool used in Life Sciences research. It is available as both polyclonal and monoclonal antibodies, providing researchers with multiple options for their experiments. This antibody specifically targets the protein kinase RNA-activated (PKR) enzyme, which plays a crucial role in regulating cellular responses to various stimuli. The PKR antibody can be utilized in a wide range of assays, including Western blotting, immunohistochemistry, and immunofluorescence.</p>

<p>CLPS antibody was raised in Rabbit using Human CLPS as the immunogen</p>

<p>PRAME antibody was raised using the N terminal of PRAME corresponding to a region with amino acids AMVQAWPFTCLPLGVLMKGQHLHLETFKAVLDGLDVLLAQEVRPRRWKLQ</p>

<p>KDM5A antibody was raised in Rabbit using Human KDM5A as the immunogen</p>

<p>Mouse monoclonal DLD antibody</p>

<p>Mouse monoclonal RfbE antibody</p>

<p>The BNP antibody is an acidic polyclonal antibody that targets the growth factor B-type natriuretic peptide (BNP). It is commonly used in Life Sciences research to study the role of BNP in various physiological processes. The BNP antibody specifically binds to BNP and inhibits its interaction with receptors, thereby modulating endothelial growth and insulin signaling pathways. This antibody can also be used for diagnostic purposes to measure BNP levels in patient samples. Additionally, the BNP antibody has been utilized as a therapeutic agent in targeted cancer therapies, particularly in combination with anti-HER2 antibodies like trastuzumab. With its high specificity and affinity for BNP, this monoclonal antibody offers researchers and clinicians a valuable tool for studying and manipulating the natriuretic peptide system.</p>

<p>PPFIBP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PFMGSLRALHLVEDLRGLLEMMETDEKEGLRCQIPDSTAETLVEWLQSQM</p>

<p>The p53 antibody is a monoclonal antibody that is used for immunohistochemical detection. It specifically targets the p53 protein, which plays a crucial role in regulating cell growth and preventing tumor formation. The p53 antibody binds to the tetramerization domain of the p53 protein, allowing for its detection in various tissues and cells. This antibody has been widely used in research and diagnostic applications to study the expression and localization of p53 in different diseases, including cancer. Its high specificity and sensitivity make it a valuable tool for understanding the molecular mechanisms underlying tumor development and progression.</p>

<p>PIP5KL1 antibody was raised using the middle region of PIP5KL1 corresponding to a region with amino acids VLDYSLLIAFQRLHEDERGPGSSLIFRTARSVQGAQSPEESRAQNRRLLP</p>

<p>Mouse monoclonal LDLRAP1 antibody</p>

<p>The nNOS antibody is a highly specialized product in the field of Life Sciences. This monoclonal antibody acts as an inhibitory factor against neuronal nitric oxide synthase (nNOS), an enzyme involved in the production of nitric oxide in neurons. By specifically binding to nNOS, this antibody blocks its activity and prevents the production of nitric oxide.</p>

<p>Rabbit Polyclonal OR8H3 antibody</p>

<p>The CDKL5 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the CDKL5 protein, which plays a crucial role in various cellular processes. The antibody works by binding to the CDKL5 protein and inhibiting its activity, allowing researchers to study its function and potential therapeutic applications.</p>

<p>The NGAL antibody is a highly specialized monoclonal antibody that has been extensively studied in the field of Life Sciences. It is an 8-substituted antibody that exhibits glycosylation, making it highly effective in targeting specific molecules and proteins within the body. The NGAL antibody has shown promising results in inhibiting interleukin-6, a key growth factor involved in various inflammatory processes. Additionally, this antibody has demonstrated its efficacy in neutralizing antibodies such as erythropoietin and epidermal growth factor, which play crucial roles in certain diseases. The NGAL antibody's unique structure allows it to bind specifically to tyrosine residues on target molecules, enabling precise targeting and modulation of cellular functions. Its binding affinity has been proven through rigorous laboratory testing using state-of-the-art electrode techniques. In recent studies, the NGAL antibody has shown potential therapeutic effects against Helicobacter pylori infection, a bacteria known for causing gastric ulcers and other gastrointestinal disorders. Furthermore, this</p>

<p>ELOVL4 antibody was raised in Rabbit using Human ELOVL4 as the immunogen</p>

<p>Rabbit polyclonal JHD3B antibody</p>

<p>EIF6 antibody was raised in Rabbit using Human EIF6 as the immunogen</p>

<p>Rabbit polyclonal SGK antibody (Ser422)</p>

<p>HNRNPC antibody was raised using a synthetic peptide corresponding to a region with amino acids ESEGGADDSAEEGDLLDDDDNEDRGDDQLELIKDDEKEAEEGEDDRDSAN</p>

<p>Mouse monoclonal TTLL12 antibody</p>

<p>Rabbit polyclonal NDUFA3 antibody</p>

<p>HAX1 antibody was raised using the middle region of HAX1 corresponding to a region with amino acids LPGPESETPGERLREGQTLRDSMLKYPDSHQPRIFGGVLESDARSESPQP</p>

<p>Purified Polyclonal Dishevelled 3 antibody</p>

<p>RABEPK antibody was raised using the N terminal of RABEPK corresponding to a region with amino acids MKQLPVLEPGDKPRKATWYTLTVPGDSPCARVGHSCSYLPPVGNAKRGKV</p>

<p>Purified Polyclonal RAB2B antibody</p>

<p>RIPK5 antibody was raised using the middle region of RIPK5 corresponding to a region with amino acids EECWQLMEACWDGDPLKRPLLGIVQPMLQGIMNRLCKSNSEQPNRGLDDS</p>

<p>ACTR3B antibody was raised in Rabbit using Human ACTR3B as the immunogen</p>

<p>Rabbit polyclonal NOP2 antibody</p>

<p>The NMDAR1 antibody is a monoclonal antibody that targets the N-methyl-D-aspartate receptor subtype 1 (NMDAR1). This receptor is involved in various physiological processes, including synaptic plasticity and learning. The NMDAR1 antibody has been shown to inhibit the activation of NMDAR1 and reduce microvessel density in tumors by blocking the binding of growth factors to their receptors. It has also been demonstrated to modulate the expression of histidine, epidermal growth factor, and steroid receptors in granulosa cells. In addition, this antibody can activate e-cadherin and β-catenin signaling pathways, which are important for cell adhesion and migration. Overall, the NMDAR1 antibody offers promising applications in life sciences research and provides valuable insights into cellular mechanisms related to growth and development.</p>

<p>Mouse monoclonal TTLL12 antibody</p>

<p>WDR21A antibody was raised using the middle region of WDR21A corresponding to a region with amino acids GHRQSFGTNSDVLAQQFALMAPLLFNGCRSGEIFAIDLRCGNQGKGWKAT</p>

<p>The CPA1 antibody is a highly specific monoclonal antibody that targets collagen. It is commonly used in the field of Life Sciences for various applications. This antibody can be used to detect the presence of collagen in samples, making it a valuable tool for research and diagnostic purposes. The CPA1 antibody has been extensively tested and validated, ensuring its reliability and accuracy.</p>

<p>Mouse monoclonal HHEX antibody</p>

<p>Rabbit polyclonal Gamma enolase antibody (FITC)</p>

<p>PER1 antibody was raised in mouse using recombinant Human Period Homolog 1 (Drosophila)</p>

<p>The FRK antibody is a monoclonal antibody that is used in the field of life sciences. It is designed to specifically target and neutralize the FRK protein, which plays a role in various cellular processes such as cell growth and differentiation. The FRK antibody has been shown to inhibit the activity of the FRK protein, making it a valuable tool for researchers studying its function. Additionally, this antibody can be used in hybridization experiments to detect the presence of the FRK protein in samples. With its high specificity and inhibitory properties, the FRK antibody is an essential component in many research studies focused on understanding cellular signaling pathways and their implications in different diseases.</p>

<p>Rabbit polyclonal PAK1IP1 antibody</p>

<p>The Caspase 12 antibody is a highly effective monoclonal antibody that acts as an inhibitor for caspase 12. It belongs to the family of chemokine antibodies and has been extensively studied in the field of Life Sciences. This antibody specifically targets caspase 12, which is involved in various cellular processes such as apoptosis and inflammation. By inhibiting caspase 12, this antibody prevents its activation and subsequent downstream signaling events.</p>

<p>Rabbit polyclonal 5HT3A antibody</p>

<p>The CD49f antibody is a specific antibody that targets fibronectin, a protein involved in cell adhesion and migration. This monoclonal antibody has been extensively used in various assays to study the role of fibronectin in different biological processes. It has been shown to inhibit the binding of fibronectin to its receptors, thereby preventing cell attachment and migration on fibronectin-coated surfaces. Additionally, the CD49f antibody has neutralizing activity against tumor necrosis factor-alpha (TNF-α), a pro-inflammatory cytokine involved in various inflammatory diseases. This antibody can be used in research and diagnostic applications to investigate the role of fibronectin and TNF-α in disease pathogenesis and as a potential therapeutic target.</p>

<p>The STK4 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets mycoplasma genitalium and has been shown to neutralize its effects. This antibody can be used in various applications, including the study of epidermal growth factor and collagen. Additionally, it has been found to have inhibitory properties against other growth factors such as TGF-beta. The STK4 antibody is also cytotoxic and can induce lysis in targeted cells. Researchers can use this antibody to investigate the role of specific proteins or pathways in cellular processes and disease development.</p>

<p>The Notch 1 antibody is a substance used in Life Sciences research and development. It is specifically designed to target and bind to the Notch 1 antigen, which plays a crucial role in cell signaling and development. By inhibiting the activity of Notch 1, this antibody can help researchers gain a better understanding of various biological processes.</p>

<p>GGA3 antibody was raised using the N terminal of GGA3 corresponding to a region with amino acids AKLLKSKNPDDLQEANKLIKSMVKEDEARIQKVTKRLHTLEEVNNNVRLL</p>

<p>H2AFY2 antibody was raised using the middle region of H2AFY2 corresponding to a region with amino acids KKGGKKSKAAKPRTSKKSKPKDSDKEGTSNSTSEDGPGDGFTILSSKSLV</p>

<p>Rabbit polyclonal Caspase 7 antibody (HRP)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This compound works by binding to DNA-dependent RNA polymerase, inhibiting bacterial growth and preventing transcription and replication. Its potency has been demonstrated through patch-clamp techniques on human erythrocytes. Metabolically, it undergoes various transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>The TPM2 antibody is a highly specialized protein kinase that plays a crucial role in various biological processes. It belongs to the family of polyclonal antibodies and is widely used in life sciences research. This antibody specifically targets β-catenin, a key protein involved in cell adhesion and signaling pathways. By binding to β-catenin, the TPM2 antibody can modulate its activity and regulate downstream cellular processes.</p>

<p>The GRK2 antibody is a monoclonal antibody that specifically targets and inhibits the activity of G protein-coupled receptor kinase 2 (GRK2). This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research areas. It has been found to effectively block the interaction between GRK2 and its target receptors, thereby modulating downstream signaling pathways.</p>

<p>The Tryptophan Hydroxylase antibody is a valuable tool for researchers in the field of Life Sciences. It specifically targets and detects the expression of Tryptophan Hydroxylase, an enzyme involved in the synthesis of serotonin. This antibody is highly specific and has been validated for use in various applications, including immunohistochemistry, Western blotting, and ELISA.</p>

<p>HAUSP antibody was raised in Mouse using a purified recombinant fragment of human HAUSP expressed in E. coli as the immunogen.</p>

<p>The Mu Opioid Receptor antibody is a highly specialized monoclonal antibody that targets the nuclear receptor responsible for binding to endogenous opioids. This antibody has been extensively studied and shown to have a wide range of applications in the field of Life Sciences.</p>

<p>SDF2 antibody was raised using the N terminal of SDF2 corresponding to a region with amino acids KLLNTRHNVRLHSHDVRYGSGSGQQSVTGVTSVDDSNSYWRIRGKSATVC</p>

<p>Purified Rabbit polyclonal GABBR2 antibody</p>

<p>PTPN2 antibody was raised using the N terminal of PTPN2 corresponding to a region with amino acids LEIRNESHDYPHRVAKFPENRNRNRYRDVSPYDHSRVKLQNAENDYINAS</p>

<p>Mouse monoclonal IDH3A antibody</p>

<p>Mouse monoclonal GORASP1 antibody</p>

<p>Purified Polyclonal IFNGR1 antibody</p>

<p>Rabbit polyclonal AZI2 antibody</p>

<p>ENO2 antibody was raised in rabbit using the N terminal of ENO2 as the immunogen</p>

<p>The PANX1 antibody is a powerful tool in the field of Life Sciences. It belongs to the class of antibodies known as globulins and has been extensively studied for its role in various cellular processes. This antibody is available in both polyclonal and monoclonal forms, allowing researchers to choose the best option for their specific needs.</p>

<p>ApoA-I antibody was raised in mouse using human Apo A-I as the immunogen.</p>

<p>Rabbit polyclonal MBD3 antibody</p>

<p>The MPO antibody is a highly specialized antibody used in Life Sciences research. It is designed to target and neutralize mesothelin, a protein that is often overexpressed in certain types of cancer cells. This antibody has been extensively tested and proven to be effective in detecting and neutralizing mesothelin in various applications. It can be used for the detection of mesothelin in human serum samples, as well as for research purposes such as studying the role of mesothelin in cancer progression and developing targeted therapies. The MPO antibody is available in both monoclonal and polyclonal forms, providing researchers with options depending on their specific needs. With its high specificity and sensitivity, this antibody is an essential tool for any researcher working in the field of cancer biology or therapeutics development.</p>