Primary Antibodies

<p>CD4a antibody was raised in mouse using CD4a as the immunogen.</p>

<p>Rabbit polyclonal PPP1R15B antibody</p>

<p>The BNP antibody is a monoclonal antibody that specifically targets brain natriuretic peptide (BNP). It is designed for use in various applications, including immunoassays and research studies. This antibody has been shown to effectively detect BNP in human serum samples, making it a valuable tool for diagnostic purposes.</p>

<p>Affinity purified Rabbit polyclonal Calpain 5 antibody</p>

<p>Purified Polyclonal ARHGEF1 antibody</p>

<p>Purified Rabbit polyclonal MKK9t antibody</p>

<p>C17ORF81 antibody was raised using the C terminal Of C17Orf81 corresponding to a region with amino acids FSILPDFSLDLQEGPSVESQPYSDPHIPPVSKNAKARTRKCSLVSGHGRE</p>

<p>Rabbit polyclonal XRN2 antibody</p>

<p>Affinity purified Chicken polyclonal Integrin alpha M antibody</p>

<p>FAM98B antibody was raised using the N terminal of FAM98B corresponding to a region with amino acids LTKAAEGGLSSPEFSELCIWLGSQIKSLCNLEESITSAGRDDLESFQLEI</p>

<p>MMACHC antibody was raised in rabbit using the C terminal of MMACHC as the immunogen</p>

<p>TERF2IP antibody was raised using the middle region of TERF2IP corresponding to a region with amino acids EDPEAADSGEPQNKRTPDLPEEEYVKEEIQENEEAVKKMLVEATREFEEV</p>

<p>BAG5 antibody was raised in rabbit using the C terminal of BAG5 as the immunogen</p>

<p>Rabbit polyclonal PPM1K antibody</p>

<p>CD11b antibody was raised in mouse using human CD11-b`/Mac-1alpha as the immunogen.</p>

<p>CKMT1A antibody was raised in Rabbit using Human CKMT1A as the immunogen</p>

<p>Affinity purified Rabbit polyclonal PODXL2 antibody</p>

<p>Rabbit polyclonal AP2S1 antibody (HRP)</p>

<p>Rabbit polyclonal Adiponectin antibody (HRP)</p>

<p>Rabbit polyclonal NUDT16 antibody</p>

<p>The Aggrecan antibody is a growth factor that belongs to the class of antibodies. It is a monoclonal antibody with low density and globulin inhibitors. This antibody specifically targets hyaluronic acid, epidermal growth factor, antigens, interferons, and fatty acids. The Aggrecan antibody is widely used in the field of life sciences and has been shown to have neutralizing effects on its target molecules. Its high specificity and efficacy make it an essential tool for researchers in various scientific disciplines.</p>

<p>The BRD3 antibody is a highly specialized antibody preparation that has various applications in the field of life sciences. It is commonly used in research involving pluripotent stem cells, antimicrobial peptides, and interleukin-6. This antibody has been shown to induce apoptosis and neutralize certain growth factors, making it an essential tool for studying cellular processes and signaling pathways. The BRD3 antibody can be used in techniques such as transcription-polymerase chain reaction (PCR) and mitogen-activated protein assays. It is available both as polyclonal antibodies and monoclonal antibodies, providing researchers with options based on their specific needs. Additionally, this antibody can be used in conjunction with AMPK activators and colony-stimulating factors to further enhance its effects. With its versatility and reliability, the BRD3 antibody is an invaluable asset for scientists conducting cutting-edge research in various fields of study within the life sciences domain.</p>

<p>PGBD2 antibody was raised using the middle region of PGBD2 corresponding to a region with amino acids RICCQDAQVDLLAFRRYIACVYLESNADTTSQGRRSRRLETESRFDMIGH</p>

<p>CD207 antibody was raised in Rabbit using Human CD207 as the immunogen</p>

<p>The CKMB Antibody is a highly specialized monoclonal antibody that has been developed for use in the field of Life Sciences. It is specifically designed to target and bind to the CKMB protein, which is an important biomarker for various cardiac conditions.</p>

<p>Purified Polyclonal THRB antibody</p>

<p>Purified Polyclonal Nop30 antibody</p>

<p>TGF beta 1 antibody was raised in mouse using highly pure recombinant human TGF-beta1 as the immunogen.</p>

<p>GALE antibody was raised in Rabbit using Human GALE as the immunogen</p>

<p>CDA antibody was raised in rabbit using the C terminal of CDA as the immunogen</p>

<p>Affinity purified Rabbit polyclonal CaMK1D antibody</p>

<p>Rabbit polyclonal PTPRR antibody</p>

<p>CYP17A1 antibody was raised in Rabbit using Human CYP17A1 as the immunogen</p>

<p>ERBB3 antibody was raised in Mouse using a purified recombinant fragment of ERBB3(aa1175-1275) expressed in E. coli as the immunogen.</p>

<p>Purified Polyclonal Tetraspanin 8 antibody</p>

<p>Purified Polyclonal RPS4Y1 antibody</p>

<p>FAM49B antibody was raised in Rabbit using Human FAM49B as the immunogen</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its effectiveness has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. Additionally, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Notably, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically binds to markers expressed at high levels in Mycobacterium tuberculosis strains and hinders cell growth in culture.</p>

<p>Rabbit polyclonal Lyl1 antibody</p>

<p>Rabbit polyclonal MADD antibody</p>

<p>The SRF antibody is a powerful tool in biomedical research and diagnostics. It is an antibody that specifically targets the growth factor known as SRF (Serum Response Factor). This growth factor plays a crucial role in cell proliferation, differentiation, and survival. The SRF antibody can be used to study the function of SRF in various biological processes, including development, tissue repair, and disease progression.</p>

<p>PTK2B antibody was raised using the C terminal of PTK2B corresponding to a region with amino acids QKQMVEDYQWLRQEEKSLDPMVYMNDKSPLTPEKEVGYLEFTGPPQKPPR</p>

<p>ELMOD1 antibody was raised in Rabbit using Human ELMOD1 as the immunogen</p>

<p>Rabbit polyclonal MEOX2 antibody</p>

<p>The MST4 antibody is a chimeric protein that falls under the category of Life Sciences. It is a monoclonal antibody that specifically targets MST4, a protein involved in various cellular processes. This antibody has been extensively studied and characterized for its high specificity and affinity towards MST4.</p>

<p>Rabbit polyclonal HLAB antibody (HRP)</p>

<p>CPLX4 antibody was raised in Rabbit using Human CPLX4 as the immunogen</p>

<p>Psuedomonas polyclonal biotin conjugate</p>

<p>Purified Polyclonal TESK1 antibody</p>

<p>DSTN antibody was raised in Rabbit using Human DSTN as the immunogen</p>

<p>The MtSSB antibody is a diagnostic biomarker that plays a crucial role in various biological processes. It is a proline-rich protein that has been extensively studied for its potential applications in medicine. The emission of caveolin-1 and palmitate have been shown to be influenced by the presence of MtSSB antibodies. These antibodies have the ability to inhibit interferon signaling, making them valuable tools for research and diagnostics in the field of Life Sciences. As polyclonal antibodies, they can serve as a reliable detection reagent for identifying and quantifying MtSSB in samples. Additionally, their inhibitory properties make them an attractive target for developing therapeutic strategies against diseases involving reductase activity.</p>

<p>The PHEX antibody is a highly specialized polyclonal antibody that targets the hormone peptide interleukin-6 (IL-6). It is produced using a hybridoma cell line, which ensures high specificity and potency. This antibody acts as an inhibitory factor, neutralizing the effects of IL-6 and preventing its interaction with receptors.</p>

<p>Rabbit polyclonal DNAPK antibody</p>

<p>CHTF18 antibody was raised in Rabbit using Human CHTF18 as the immunogen</p>

<p>Rabbit polyclonal ERP29 antibody</p>

<p>Histone H4 (tri methyl K20) Monoclonal Antibody</p>

<p>The CCL2 antibody is a monoclonal antibody that targets the chemokine CCL2, also known as monocyte chemoattractant protein-1 (MCP-1). It is used in Life Sciences research to study the role of CCL2 in various physiological and pathological processes. This antibody specifically binds to CCL2 and can be used for applications such as immunohistochemistry, flow cytometry, and ELISA. The CCL2 antibody has been shown to inhibit the interaction between CCL2 and its receptor, thereby blocking the recruitment of monocytes and other immune cells to inflammatory sites. It is also nephrotoxic in nature, which means it can cause damage to kidney cells. Additionally, polyclonal antibodies derived from human serum or monoclonal antibodies like adalimumab can be used as alternatives to the CCL2 antibody for specific research purposes.</p>

<p>CAV3 antibody was raised in rabbit using the N terminal of CAV3 as the immunogen</p>

<p>ST5 antibody was raised in rabbit using the middle region of ST5 as the immunogen</p>

<p>The Glyoxalase I antibody is a neuroprotective glycosylation inhibitor that targets glycopeptides such as transferrin, insulin, and fibronectin. It is widely used in Life Sciences research to study the role of glycosylation in various biological processes. This polyclonal antibody specifically binds to acidic collagens and has been shown to be effective in detecting antiphospholipid antibodies and autoantibodies. Additionally, it can be used as an insulin antibody for studying insulin signaling pathways. The Glyoxalase I antibody is a valuable tool for researchers investigating glycosylation-related mechanisms and can serve as an anticoagulant in certain applications. With its high specificity and sensitivity, this antibody is an essential component of any laboratory working with Polyclonal Antibodies.</p>

<p>CBR1 antibody was raised in mouse using recombinant human CBR1 (1-277 aa ) purified from E. coli</p>

<p>The DBH antibody is a highly specialized antibody used in the field of Life Sciences. It is commonly used for research purposes and is designed to specifically target and bind to dopamine beta-hydroxylase (DBH). DBH is an enzyme that plays a crucial role in the synthesis of norepinephrine, a neurotransmitter involved in various physiological processes.</p>

<p>RPL9 antibody was raised using the C terminal of RPL9 corresponding to a region with amino acids GVACSVSQAQKDELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIY</p>

<p>Factor XIIIa antibody is a powerful tool used in Life Sciences research for its ability to target and detect Factor XIIIa, an enzyme involved in blood clot formation. This polyclonal antibody specifically binds to Factor XIIIa, allowing researchers to study its role in various biological processes.</p>

<p>SC4MOL antibody was raised using the N terminal of SC4MOL corresponding to a region with amino acids MATNESVSIFSSASLAVEYVDSLLPENPLQEPFKNAWNYMLNNYTKFQIA</p>

<p>Rabbit polyclonal EGR3 antibody</p>

<p>CYP51A1 antibody was raised in rabbit using the N terminal of CYP51A1 as the immunogen</p>

<p>ENTPD8 antibody was raised in Rabbit using Human ENTPD8 as the immunogen</p>

<p>Rabbit polyclonal CKMM antibody (biotin)</p>

<p>COMMD1 antibody was raised in Rabbit using Human COMMD1 as the immunogen</p>

<p>COX15 antibody was raised using a synthetic peptide corresponding to a region with amino acids DWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTEFKFIWYMEY</p>

<p>Purified Polyclonal AKAP17A antibody</p>

<p>DDOST antibody was raised in Rabbit using Human DDOST as the immunogen</p>

<p>AP1G1 antibody was raised in Rabbit using Human AP1G1 as the immunogen</p>

<p>Rabbit polyclonal NRBP2 antibody</p>

<p>H-2Db antibody (PE) was raised in mouse using C57B/10 mouse skin graft and splenocytes as the immunogen.</p>

<p>CSK antibody was raised in Rabbit using Human CSK as the immunogen</p>

<p>CD8 antibody was raised in Mouse using a purified recombinant fragment of human CD8 expressed in E. coli as the immunogen.</p>

<p>The CXCL1 antibody is a powerful tool in the field of Life Sciences. It functions as a growth factor and has been shown to interact with epidermal growth factor receptors, protein kinases, and phosphatases. This monoclonal antibody exhibits cytotoxic properties and can be used for various applications in research and diagnostics.</p>

<p>The Apolipoprotein E4 Antibody is a highly specialized monoclonal antibody that targets and neutralizes the effects of Apolipoprotein E4 (APOE4). APOE4 is a human protein that has been associated with various health conditions, including Alzheimer's disease and cardiovascular disorders. This antibody specifically binds to APOE4, preventing its interaction with other molecules in the body.</p>

<p>Rabbit polyclonal CD249 antibody (biotin)</p>

<p>ELF2 antibody was raised in Rabbit using Human ELF2 as the immunogen</p>

<p>The PCTK1 antibody is a powerful tool used in Life Sciences research. It is a polyclonal antibody that specifically targets the alpha-fetoprotein (AFP), a protein commonly associated with liver development and certain types of cancer. This antibody has been extensively tested and validated for its specificity and sensitivity in various experimental settings.</p>

<p>Rabbit polyclonal SMG7 antibody</p>

<p>Purified Rabbit polyclonal U12 antibody</p>

<p>PRSS22 antibody was raised using the N terminal of PRSS22 corresponding to a region with amino acids IPVPPACGKPQQLNRVVGGEDSTDSEWPWIVSIQKNGTHHCAGSLLTSRW</p>

<p>Rabbit polyclonal Thioredoxin antibody (HRP)</p>

<p>Alpha 2 antiplasmin antibody was raised in mouse using purified alpha-2 antiplasmin as the immunogen.</p>

<p>The Tenascin antibody is a highly specialized recombinant protein that belongs to the class of chemokines. It is designed to target specific antigens and has been extensively studied in the field of Life Sciences. This antibody exhibits strong binding affinity towards glycoproteins, making it an ideal tool for research purposes. It has also been used in studies related to hyperammonemia and shows promising results in inhibiting the growth of cancer cells, such as MCF-7. The Tenascin antibody is available in both polyclonal and monoclonal forms, providing researchers with options based on their specific needs. With its ability to effectively neutralize target proteins, this antibody holds great potential for therapeutic applications, including the development of antibody-drug conjugates. Whether you're conducting cutting-edge research or exploring new avenues in drug discovery, the Tenascin antibody is a valuable tool that can significantly contribute to your scientific endeavors.</p>

<p>Purified Rabbit polyclonal TAS2R43 antibody</p>

<p>EPHX2 antibody was raised in Rabbit using Human EPHX2 as the immunogen</p>

<p>The GLUT1 antibody is a monoclonal antibody used in the field of Life Sciences. It specifically targets the glycoprotein GLUT1, which plays a crucial role in glucose transport across cell membranes. This antibody has been extensively studied and proven to be highly effective in various research applications.</p>

<p>The YAP1 antibody is a monoclonal antibody that plays a crucial role in various biological processes. It has been extensively studied in the field of Life Sciences due to its ability to target specific proteins and molecules. This antibody has shown promising results in inhibiting the activation of fibrinogen, which is involved in blood clotting. Additionally, it has been found to interact with statins, chemical agents that are commonly used for cholesterol management, and modulate their effects.</p>

<p>CENPO antibody was raised in Rabbit using Human CENPO as the immunogen</p>

<p>Rabbit polyclonal KPB1/2 antibody</p>

<p>Cytokeratin 10-1 Monoclonal Antibody</p>

<p>Rabbit polyclonal ADORA1 antibody</p>

<p>Rabbit Polyclonal STAT3 antibody (Ser727)</p>

<p>MGST3 antibody was raised in rabbit using the N terminal of MGST3 as the immunogen</p>

<p>Rabbit polyclonal YARS antibody (FITC)</p>