Primary Antibodies

<p>CLIP1 antibody was raised in rabbit using the C terminal of CLIP1 as the immunogen</p>

<p>GAN antibody was raised in Rabbit using Human GAN as the immunogen</p>

<p>Acetyl Lysine Monoclonal Antibody (HRP)</p>

<p>DPM1 antibody was raised in Rabbit using Human DPM1 as the immunogen</p>

<p>GADL1 antibody was raised in Rabbit using Human GADL1 as the immunogen</p>

<p>Rabbit polyclonal JKIP2 antibody</p>

<p>Rabbit polyclonal PEX11G antibody</p>

<p>WDR51B antibody was raised using the N terminal of WDR51B corresponding to a region with amino acids GNLLASASRDRTVRLWIPDKRGKFSEFKAHTAPVRSVDFSADGQFLATAS</p>

<p>Mouse monoclonal Reticulon 1A antibody</p>

<p>Purified Polyclonal PRRX2 antibody</p>

<p>IL23 antibody is an immunosuppressant that belongs to the class of monoclonal antibodies. It specifically targets IL-23, a cytokine involved in immune responses and inflammation. By binding to IL-23, this antibody prevents its interaction with its receptor, thereby inhibiting the downstream signaling pathways that lead to inflammation. IL23 antibody has been shown to effectively reduce the production of pro-inflammatory cytokines and inhibit the activation of immune cells. This antibody is commonly used in research and clinical settings to study the role of IL-23 in various diseases, including autoimmune disorders and cancer. Its high specificity and potency make it a valuable tool for investigating the therapeutic potential of targeting IL-23 in these conditions.</p>

<p>Rabbit polyclonal GALK1 antibody</p>

<p>The PSTAIR antibody is a highly versatile and potent tool in the field of Life Sciences. This monoclonal antibody has been extensively studied and proven to have a wide range of applications. It has shown exceptional binding affinity to various targets, including growth factors, influenza hemagglutinin, collagen, alpha-fetoprotein, fibrinogen, and many more.</p>

<p>DCUN1D1 antibody was raised in Rabbit using Human DCUN1D1 as the immunogen</p>

<p>The SSB antibody is a highly specific monoclonal antibody that targets and binds to the SSB protein. This antibody has cytotoxic effects on cancer cells, making it a valuable tool in cancer research and treatment. It has been shown to induce apoptosis in cardiomyocytes and inhibit the activation of β-catenin, a key regulator of cell proliferation and differentiation. The SSB antibody also reacts with pancreatic glucagon-producing cells, making it useful for studying pancreatic function and diabetes. Additionally, this antibody can be used in diagnostic tests to detect autoantibodies associated with certain autoimmune diseases. With its high specificity and versatility, the SSB antibody is an essential tool for researchers in the life sciences field.</p>

<p>The GST antibody is a highly reactive and cytotoxic monoclonal antibody that is commonly used in Life Sciences research. It specifically targets the glutathione S-transferase (GST) protein, which plays a crucial role in detoxification processes within cells. The GST antibody can be used to detect and quantify GST levels in various samples, including human serum.</p>

<p>Rabbit polyclonal DFF45 antibody</p>

<p>Rabbit polyclonal COX5A antibody</p>

<p>Rabbit polyclonal ZNF488 antibody</p>

<p>Rabbit polyclonal PHF11 antibody</p>

<p>HSD17B14 antibody was raised using a synthetic peptide corresponding to a region with amino acids RVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLD</p>

<p>Rabbit polyclonal ERP29 antibody</p>

<p>AMICA1 antibody was raised in Rabbit using Human AMICA1 as the immunogen</p>

<p>The Myeloperoxidase antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody specifically targets and binds to myeloperoxidase, an enzyme found in abundance in neutrophils and monocytes. By binding to myeloperoxidase, this antibody can be used for a variety of applications including immunohistochemistry, flow cytometry, and Western blotting.</p>

<p>CAD antibody was raised using the middle region of CAD corresponding to a region with amino acids SVSNNNRTSPSKPPYFDWMKKPAYPAQPQPGKTRTKDKYRVVYTDFQRLE</p>

<p>CAS antibody is a polyclonal antibody that is widely used in the field of Life Sciences. It is colloidal in nature and has been proven to be effective in detecting microvessel density. This antibody specifically targets tumor necrosis factor-alpha (TNF-α) and can be used for various applications, such as immunohistochemistry and Western blotting. CAS antibody also has the ability to bind to mimetic peptides and nuclear proteins, making it a versatile tool for research purposes. Additionally, this antibody can be used as a cross-linking agent in polymerase chain reactions (PCR) and has been shown to activate vascular endothelial growth factor-C (VEGF-C), which plays a crucial role in angiogenesis. With its high specificity and reliability, CAS antibody is an essential component for any laboratory studying cellular processes and protein interactions.</p>

<p>Rabbit polyclonal TNFL4 antibody</p>

<p>Rabbit polyclonal Interferon gamma antibody (biotin)</p>

<p>Rabbit polyclonal RPL17 antibody (biotin)</p>

<p>Rabbit polyclonal PGS1 antibody</p>

<p>Rabbit polyclonal GRK7 antibody</p>

<p>GALR2 antibody was raised in rabbit using the C terminal of GALR2 as the immunogen</p>

<p>CKAP4 antibody was raised in Rabbit using Human CKAP4 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal Lamin A/C antibody</p>

<p>EXTL3 antibody was raised in Rabbit using Human EXTL3 as the immunogen</p>

<p>PARD6B antibody was raised using a synthetic peptide corresponding to a region with amino acids MNRSHRHGAGSGCLGTMEVKSKFGAEFRRFSLERSKPGKFEEFYGLLQHV</p>

<p>IL3 antibody is a polyclonal antibody that specifically targets and binds to IL3, a cytokine involved in the regulation of hematopoiesis. This antibody has been shown to effectively disrupt the interaction between IL3 and its receptor, leading to the inhibition of downstream signaling pathways. It can be used for various applications, such as immunohistochemistry, immunofluorescence, and western blotting. The IL3 antibody has high affinity and specificity for IL3, ensuring reliable and accurate detection. Whether you're studying the role of IL3 in cancer progression or investigating its potential as a therapeutic target, this antibody is an essential tool for your research. With its robust performance and consistent results, the IL3 antibody will help advance your understanding of hematopoiesis and contribute to scientific breakthroughs in the field.</p>

<p>Rabbit polyclonal CYB5R3 antibody (HRP)</p>

<p>Affinity purified Rabbit polyclonal PNPLA6 antibody</p>

<p>Purified Polyclonal PSMD2 antibody</p>

<p>The CDH16 antibody is a polyclonal antibody that is highly effective in targeting specific proteins involved in various cellular processes. This antibody has cytotoxic properties and has been shown to inhibit the growth of cancer cells by targeting c-myc, insulin, erythropoietin, and anti-VEGF. It can be used in a variety of assays and research applications in the field of Life Sciences. The CDH16 antibody specifically targets growth factors and endothelial growth, making it an essential tool for studying cellular pathways and identifying potential therapeutic targets.</p>

<p>Rabbit polyclonal OTUD7B antibody</p>

<p>CEP63 antibody was raised in Rabbit using Human CEP63 as the immunogen</p>

<p>Rabbit Polyclonal cJun antibody</p>

<p>CD4 antibody (biotin) was raised in mouse using chicken CD4 as the immunogen</p>

<p>Rabbit polyclonal ARRDC2 antibody</p>

<p>Purified Polyclonal STK33 antibody</p>

<p>CPA2 antibody was raised in Rabbit using Human CPA2 as the immunogen</p>

<p>Annexin A6 antibody was raised using the N terminal of ANXA6 corresponding to a region with amino acids ALYTAMKGFGSDKEAILDIITSRSNRQRQEVCQSYKSLYGKDLIADLKYE</p>

<p>CERCAM antibody was raised in Rabbit using Human CERCAM as the immunogen</p>

<p>Rabbit polyclonal Mammaglobin B antibody</p>

<p>The NONO antibody is a highly specialized antibody used in Life Sciences research. It specifically targets the protein NONO, which plays a crucial role in various cellular processes. This polyclonal antibody is designed to recognize and bind to NONO with high specificity and affinity.</p>

<p>Affinity purified Rabbit polyclonal PPP1R15B antibody</p>

<p>Rabbit polyclonal Calmodulin antibody (biotin)</p>

<p>C4ORF20 antibody was raised using the middle region of C4Orf20 corresponding to a region with amino acids TPVMIGGGVLAHTILGVAWNEITGQIKFLILDPHYTGAEDLQVILEKGWC</p>

<p>EGLN1 antibody was raised in Rabbit using Human EGLN1 as the immunogen</p>

<p>The GFAP antibody is a highly specialized monoclonal antibody that targets the glial fibrillary acidic protein (GFAP). This antibody is widely used in Life Sciences research to study various aspects of neurobiology and neurodegenerative diseases. It has been proven to be effective in detecting and quantifying GFAP expression in various cell types and tissues.</p>

<p>Mouse monoclonal FERMT2 antibody</p>

<p>CSH1 antibody was raised in Rabbit using Human CSH1 as the immunogen</p>

<p>PAPOLG antibody was raised using a synthetic peptide corresponding to a region with amino acids SVDAIGGESMPIPTIDTSRKKRLPSKELPDSSSPVPANNIRVIKNSIRLT</p>

<p>The SHC antibody is a monoclonal antibody that acts as an inhibitor. It is widely used in the field of Life Sciences for various applications. This antibody specifically targets phosphatase, which plays a crucial role in cellular signaling pathways. By inhibiting phosphatase activity, the SHC antibody prevents the dephosphorylation of proteins involved in important cellular processes.</p>

<p>Mouse monoclonal SIL1 antibody</p>

<p>Mouse monoclonal CTDSP1 antibody</p>

<p>NPM antibody was raised in mouse using recombinant human NPM (81-294aa) purified from E. coli as the immunogen.</p>

<p>The SSX1 antibody is a monoclonal antibody that specifically targets the activated form of the elastase protein. It acts as a cation channel blocker, inhibiting the influx of potassium and natriuretic ions. This antibody has been extensively studied in various nuclear assays and has shown high specificity for its target. It can be used in research laboratories to detect and quantify the presence of SSX1 in human serum samples. Additionally, this antibody has potential applications in the field of Life Sciences, particularly in studies related to fibrinogen and lipoprotein lipase. With its exceptional binding affinity and selectivity, the SSX1 antibody is a valuable tool for researchers investigating cellular processes and molecular interactions.</p>

<p>BIRC2 antibody was raised in Rabbit using Human BIRC2 as the immunogen</p>

<p>Mouse monoclonal IL21 antibody (biotin)</p>

<p>Goat anti Rat IgA secondary antibody (Alk Phos)</p>

<p>Rabbit polyclonal WRKY10 antibody</p>

<p>Rabbit polyclonal VTI1B antibody</p>

<p>Rabbit polyclonal TIAF1 antibody</p>

<p>Rabbit polyclonal EXTL3 antibody (biotin)</p>

<p>Rabbit polyclonal RUSC1 antibody</p>

<p>The BAT antibody is a highly specific monoclonal antibody that is used in various assays to detect and measure the levels of interferon (IFN) in biological samples. This antibody has been extensively validated and proven to be highly sensitive and specific for IFN detection. It has been shown to neutralize the activity of IFN, making it an essential tool for studying the role of IFN in various biological processes.</p>

<p>Rabbit polyclonal PSMD11 antibody</p>

<p>The Bax antibody is a monoclonal antibody that specifically targets the Bax protein, an important regulator of apoptosis. This antibody recognizes both the amino-terminal and carboxyl-terminal regions of the Bax protein, making it highly effective in detecting and studying Bax expression in various biological samples.</p>

<p>The MIOX antibody is a highly specialized monoclonal antibody that is widely used in the field of Life Sciences. It is specifically designed to target and bind to trastuzumab, a steroid-activated monoclonal antibody. The MIOX antibody has been extensively studied and proven to have low density, allowing for enhanced binding affinity to its target.</p>

<p>4EBP1 antibody was raised in Mouse using a purified recombinant fragment of 4EBP1 expressed in E. coli as the immunogen.</p>

<p>FCER1A antibody was raised in Rabbit using Human FCER1A as the immunogen</p>

<p>Rabbit polyclonal MCHR2 antibody</p>

<p>Mouse monoclonal ALDH3A2 antibody</p>

<p>Rabbit Polyclonal Tsc2 antibody (Ser1254)</p>

<p>Rabbit polyclonal PIGK antibody</p>

<p>EIF5A antibody was raised in Rabbit using Human EIF5A as the immunogen</p>

<p>SENP3 antibody was raised using the N terminal of SENP3 corresponding to a region with amino acids PPPKPRLKSGGGFGPDPGSGTTVPARRLPVPRPSFDASASEEEEEEEEEE</p>

<p>The RBM10 antibody is a highly specialized protein that plays a crucial role in various biological processes. It acts as a growth factor and chemokine, promoting the growth and development of cells. Additionally, it has been found to bind to specific receptors such as hepatocyte growth factor and CXCR4, further enhancing its biological activity.</p>

<p>Affinity purified Rabbit polyclonal NDUFS1 antibody</p>

<p>Mouse anti-Creatine Kinase BB (CK-BB) antibody</p>

CENPI antibody was raised using the N terminal of CENPI corresponding to a region with amino acids SPQKRVKNVQAQNRTSQGSSSFQTTLSAWKVKQDPSNSKNISKHGQNNPV

<p>The CD171 antibody is a monoclonal antibody that specifically targets the alpha-synuclein antigen. It is widely used in Life Sciences research to study the role of alpha-synuclein in various diseases and conditions. The CD171 antibody binds to specific epitopes on alpha-synuclein, allowing researchers to detect and analyze its presence in samples. This antibody is highly sensitive and can be used for both qualitative and quantitative analysis. Additionally, it has been shown to have a high affinity for soluble forms of alpha-synuclein, making it a valuable tool for studying its distribution and localization in tissues and body fluids. The CD171 antibody can be used in various techniques such as immunohistochemistry, Western blotting, ELISA, and polymerase chain reaction (PCR) assays. Its use has contributed significantly to our understanding of alpha-synuclein-related diseases and may have potential applications in diagnostics and therapeutics development.</p>

<p>Keratin K5/K8 (Pan Epithelial) antibody (FITC) was raised in mouse using human keratin K8, purified from SDS PAGE gel as the immunogen.</p>

<p>Rabbit polyclonal FAKD3 antibody</p>

<p>Rabbit polyclonal RPL23 antibody</p>

<p>SSBP3 antibody was raised using the middle region of SSBP3 corresponding to a region with amino acids SNFPMGPGSDGPMGGMGGMEPHHMNGSLGSGDIDGLPKNSPNNISGISNP</p>

<p>HNRNPA1 antibody was raised in Rabbit using Human HNRNPA1 as the immunogen</p>

<p>The HAV VP1 antibody is a monoclonal antibody that specifically targets the nuclear protein VP1 of the Hepatitis A virus (HAV). This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications.</p>

<p>UBP1 antibody was raised in mouse using recombinant Human Upstream Binding Protein 1 (Lbp-1A)</p>

<p>KIAA1333 antibody was raised using the N terminal of KIAA1333 corresponding to a region with amino acids IWQRGKEEEGVYGFLIEDIRKEVNRASKLKCCVCKKNGASIGCVAPRCKR</p>

<p>Rabbit polyclonal SAPS1 antibody</p>

<p>GCLC antibody was raised using the N terminal of GCLC corresponding to a region with amino acids VLETLQEKGERTNPNHPTLWRPEYGSYMIEGTPGQPYGGTMSEFNTVEAN</p>