Primary Antibodies

<p>ASNA1 antibody was raised in rabbit using the C terminal of ASNA1 as the immunogen</p>

<p>Rabbit Polyclonal HSP90B antibody (Ser226)</p>

<p>GAPDH antibody was raised using the middle region of GAPDH corresponding to a region with amino acids KAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNC</p>

<p>The MC1R antibody is a monoclonal antibody that specifically targets the mineralocorticoid receptor (MC1R). It has been shown to interfere with the function of this receptor, which plays a crucial role in regulating various physiological processes. This antibody can be used in life sciences research to study the effects of MC1R activation or inhibition on different cellular pathways.</p>

<p>The cRaf antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and inhibit the activity of cRaf, a nuclear protein involved in various cellular processes. This antibody has been extensively studied and characterized for its ability to specifically bind to cRaf and prevent its interaction with other molecules.</p>

<p>QRSL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SYSKQYREKRKQNPHSENEDSDWLITGGSSGGSAAAVSAFTCYAALGSDT</p>

<p>The PIG3 antibody is a growth factor that specifically targets epidermal growth factor (EGF). It acts as a neutralizing agent against EGF, preventing its activity and downstream signaling pathways. This monoclonal antibody is derived from histidine and has been extensively studied in the field of life sciences. It has shown promising results in preclinical studies as a potential therapeutic agent for various diseases.</p>

<p>The D-dimer antibody is a highly specialized product used in the field of Life Sciences. It is an electrode-activated monoclonal antibody that exhibits cytotoxic properties. This antibody specifically targets transthyretin and acts as an anti-connexin agent. It is commonly used in various assays and tests to detect the presence of D-dimer in human serum, which is an important marker for blood clotting disorders. Additionally, this antibody has shown promising results in interfering with interferon signaling pathways. With its unique immobilization capabilities, the D-dimer antibody offers researchers a powerful tool for studying various biological processes and developing diagnostic tools for related conditions.</p>

<p>The SHH antibody is a monoclonal antibody that specifically targets the Sonic Hedgehog (SHH) protein isoforms. It has been extensively studied in the field of Life Sciences and has shown promising results in various applications. The SHH antibody can be used in research studies to investigate the role of SHH in development, cell signaling, and disease processes.</p>

<p>Calcyclin antibody was raised in Mouse using a purified recombinant fragment of calcyclin expressed in E. coli as the immunogen.</p>

<p>Mouse monoclonal SLFNL1 antibody</p>

<p>Rabbit polyclonal SLC4A4 antibody</p>

<p>C2ORF47 antibody was raised using the middle region of C2Orf47 corresponding to a region with amino acids GASVFQVKLGNQNVETKQLLSASYEFQREFTQGVKPDWTIARIEHSKLLE</p>

Rabbit polyclonal RBM19 antibody

<p>The E7 antibody is a highly specialized product in the field of Life Sciences. It plays a crucial role in promoting endothelial growth and is widely used in various research applications. This antibody specifically targets beta-hairpin, a growth factor that regulates the development and function of endothelial cells.</p>

<p>The ETK antibody is a growth factor that has been extensively studied in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to ETK, a protein involved in various cellular processes. The ETK antibody has shown a stimulatory effect on cell growth and proliferation, making it an important tool for research in cell biology and cancer studies.</p>

<p>EPHA4 antibody was raised in Mouse using a purified recombinant fragment of EphA4(aa777-986) expressed in E. coli as the immunogen.</p>

<p>Rabbit polyclonal EFNB1 antibody</p>

<p>BBX antibody was raised in mouse using recombinant Human Bobby Sox Homolog (Drosophila) (Bbx)</p>

The SMAD4 antibody is a polyclonal antibody that plays a crucial role in various biological processes. It has been shown to interact with fatty acids and VEGF-C, which are involved in angiogenesis and lymphangiogenesis. This antibody can also bind to high polymer ubiquitin ligases, leading to the degradation of target proteins. In addition, the SMAD4 antibody has been used in DNA vaccine studies as well as in the development of monoclonal antibodies for type 1 interferon detection. It is commonly used in research laboratories and pharmaceutical companies for applications such as immunohistochemistry, Western blotting, and polymerase chain reaction (PCR). The SMAD4 antibody holds great potential for antiangiogenic therapy due to its ability to inhibit the permeability factor produced by human endothelial cells. With its wide range of applications in life sciences, this antibody is an essential tool for researchers studying various cellular processes and diseases.

<p>Rabbit polyclonal DLG2 antibody</p>

<p>The PLCG2 antibody is a highly specialized antibody that targets the PLCG2 protein. This protein plays a crucial role in various cellular processes, including signal transduction and immune response. The antibody specifically recognizes and binds to the activated form of PLCG2, inhibiting its activity and preventing further downstream signaling.</p>

<p>Full length human BCL10 immunogen, Mouse monoclonal BCL10 antibody, reactive to human</p>

<p>Rabbit polyclonal APBA3 antibody</p>

<p>Influenza A antibody was raised in mouse using Influenza A nucleoprotein as the immunogen.</p>

<p>ZAG antibody is a polyclonal antibody that specifically targets collagen, a protein found in various tissues of the body. It can be used for research purposes to study collagen-related diseases or as a diagnostic tool in detecting collagen abnormalities. Additionally, ZAG antibody has been shown to have neutralizing effects on chemokines and growth factors such as TGF-beta and epidermal growth factor. This makes it a valuable tool in studying the role of these molecules in various physiological processes. Furthermore, ZAG antibody can also be used in therapeutic applications as an inhibitor of certain proteins or as an adjunct treatment with other antibodies like trastuzumab. Its versatility and specificity make ZAG antibody an essential tool for researchers and healthcare professionals alike.</p>

<p>Rabbit polyclonal RAB1B antibody</p>

<p>The MCM3 antibody is a monoclonal antibody that specifically targets the growth factor MCM3. It acts as a neutralizing agent, inhibiting the activity of MCM3 and preventing its activation. This antibody has been widely used in Life Sciences research, particularly in studies involving trastuzumab, an anti-HER2 antibody. By blocking the interaction between MCM3 and epidermal growth factor receptors, this antibody effectively disrupts signaling pathways involved in cell growth and proliferation.</p>

<p>KCNQ4 antibody was raised using the middle region of KCNQ4 corresponding to a region with amino acids SSRMGIKDRIRMGSSQRRTGPSKQHLAPPTMPTSPSSEQVGEATSPTKVQ</p>

<p>Rabbit polyclonal PTRH2 antibody</p>

<p>Rabbit polyclonal SLC16A2 antibody</p>

<p>Rabbit polyclonal ADRB2 antibody</p>

<p>DDX23 antibody was raised in Rabbit using Human DDX23 as the immunogen</p>

<p>Mouse monoclonal HMOX2 antibody</p>

<p>The DGKA antibody is a monoclonal antibody that specifically targets the activated form of alpha-synuclein, a protein kinase involved in various cellular processes. This monoclonal antibody has been shown to exhibit cytotoxic effects on cells expressing high levels of activated alpha-synuclein. In the field of Life Sciences, this antibody is widely used for research purposes, particularly in the study of mitogen-activated protein pathways and as a tool for investigating potential therapeutic strategies. Additionally, the DGKA antibody has been found to have inhibitory effects on tyrosine kinases and nuclear proteins. With its high specificity and affinity, this antibody is an invaluable tool for scientists working in the field of protein research and drug discovery.</p>

<p>SLC7A14 antibody was raised using a synthetic peptide corresponding to a region with amino acids VAFFIGWNLILEYLIGTAAGASALSSMFDSLANHTISRWMADSVGTLNGL</p>

<p>AHSG antibody was raised in Rabbit using Human AHSG as the immunogen</p>

<p>Rabbit polyclonal PLCZ1 antibody</p>

Rabbit polyclonal TSPAN5 antibody

<p>Mouse monoclonal TPMT antibody</p>

<p>Mouse monoclonal MRAS antibody</p>

<p>The FEN1 antibody is a highly specialized neutralizing agent that targets adeno-associated virus. It is widely used in the field of Life Sciences, particularly in research related to mcf-7 cells and tumor necrosis factor-alpha (TNF-α). This antibody is known for its ability to bind to fibronectin, which plays a crucial role in cell adhesion and migration. Additionally, the FEN1 antibody has been found to regulate viscosity and modulate the effects of epidermal growth factor (EGF) and other growth factors. It is available as both a monoclonal antibody and polyclonal antibodies, making it versatile for various experimental applications. Researchers also rely on this antibody to study multidrug resistance and endothelial growth. For unparalleled precision and reliability in your experiments, choose the FEN1 antibody.</p>

<p>HDAC3 antibody was raised in Mouse using a purified recombinant fragment of human HDAC3 (aa224-428) expressed in E. coli as the immunogen.</p>

Filamin A antibody was raised in mouse using human platelet protein as the immunogen.

<p>Affinity purified Rabbit polyclonal OSGEP antibody</p>

<p>Rabbit polyclonal TAF6L antibody</p>

<p>BCO2 antibody was raised in rabbit using the C terminal of BCO2 as the immunogen</p>

<p>Mouse monoclonal PDSS2 antibody</p>

<p>IDS antibody was raised in rabbit using the N terminal of IDS as the immunogen</p>

<p>Mouse monoclonal LIN7B antibody</p>

<p>DDX20 antibody was raised in Rabbit using Human DDX20 as the immunogen</p>

<p>Rabbit polyclonal ZNF3 antibody</p>

<p>Rabbit polyclonal PSMB9 antibody</p>

<p>Rabbit polyclonal 4EBP1 antibody (Ser64)</p>

<p>The PSAT1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically target and bind to the PSAT1 protein, which plays a crucial role in cellular metabolism and growth regulation. This antibody can be used in various applications, including Western blotting, immunohistochemistry, and enzyme-linked immunosorbent assays (ELISA).</p>

<p>The SDHB antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and neutralize interleukin-6 (IL-6), an important cytokine involved in various biological processes. By inhibiting IL-6, this antibody can effectively block its signaling pathways, preventing the activation of downstream events.</p>

<p>Affinity purified Rabbit polyclonal PPP3CB antibody</p>

<p>MYL3 antibody was raised in Mouse using a purified recombinant fragment of MYL3 expressed in E. coli as the immunogen.</p>

<p>Rabbit polyclonal H2BF antibody</p>

<p>Rabbit polyclonal ARL2 antibody (HRP)</p>

<p>Mouse monoclonal TTC32 antibody</p>

<p>ANKRD42 antibody was raised using the N terminal of ANKRD42 corresponding to a region with amino acids MPGVANSGPSTSSRETANPCSRKKVHFGSIHDAVRAGDVKQLSEIVCLHW</p>

<p>The ADK antibody is a monoclonal antibody that is widely used in Life Sciences research. It plays a crucial role as a growth factor and has been extensively studied for its impact on microvessel density. The ADK antibody has shown to have anticoagulant properties, and it interacts with various factors such as TNF-α, androgens, adrenomedullin, and fibrinogen. This versatile antibody can be activated under specific conditions, making it a valuable tool in numerous experimental settings. Its high affinity and specificity make it an excellent choice for researchers looking to study the nuclear localization of specific proteins or investigate the role of fatty acids in cellular processes. For those seeking reliable and accurate results, the ADK antibody is an indispensable asset.</p>

<p>DDX58 antibody was raised in Rabbit using Human DDX58 as the immunogen</p>

<p>Purified Rabbit polyclonal POLR1C antibody</p>

<p>Mouse Monoclonal MAP2K6 antibody</p>

<p>Affinity purified Rabbit polyclonal ACTL8 antibody</p>

<p>Affinity purified Rabbit polyclonal DCAMKL2 antibody</p>

<p>Rabbit Polyclonal FAK antibody (Tyr861)</p>

<p>C14orf166 antibody was raised in Rabbit using Human C14orf166 as the immunogen</p>

<p>EXOSC1 antibody was raised in Rabbit using Human EXOSC1 as the immunogen</p>

<p>Donkey anti-Sheep IgG (H + L) (Alk Phos) was raised in donkey using purified Sheep IgG (H&amp;L) as the immunogen.</p>

<p>Rabbit polyclonal RFXAP antibody</p>

<p>PLMN antibody is an essential tool used in life sciences research for the detection and analysis of various proteins and peptides. This polyclonal antibody specifically targets c-myc, a hormone peptide that plays a crucial role in cell growth and proliferation. The PLMN antibody is highly sensitive and can detect even low levels of c-myc in samples.</p>

<p>Rabbit polyclonal LMX1B antibody</p>

<p>Mouse monoclonal BCAR1 antibody</p>

<p>GPR174 antibody was raised in rabbit using the C terminal of GPR174 as the immunogen</p>

<p>Aquaporin 4 antibody is a biomolecule that plays a crucial role in various physiological processes. It is a polyclonal antibody that specifically targets the aquaporin 4 protein, which is found in the central nervous system and plays a key role in water transport across cell membranes. This antibody is widely used in life sciences research to study the function and regulation of aquaporin 4.</p>

The ST6GALNAC1 antibody is a powerful tool for researchers in the field of life sciences. It is an antibody that specifically targets and binds to ST6GALNAC1, an enzyme involved in the synthesis of sialyl-Tn antigen. This antigen has been implicated as a diagnostic biomarker for various cancers, making the ST6GALNAC1 antibody a valuable theranostic tool.

<p>The Tip60 antibody is a monoclonal antibody that is widely used in Life Sciences research. It acts as a growth factor by neutralizing the effects of certain proteins, such as collagen and androgen. This antibody can be used in various applications, including Western blotting, immunohistochemistry, and flow cytometry. It is available as both monoclonal and polyclonal antibodies to suit different experimental needs. The Tip60 antibody has been shown to have multidrug resistance-associated protein (MRP) inhibitory activity, making it useful for studying drug resistance mechanisms. Additionally, it interacts with cytochrome proteins involved in cellular metabolism. The Tip60 antibody is formulated with low-density excipients to ensure stability and optimal performance.</p>

<p>CD86 antibody was raised in rat using LPS-activated murine B cells as the immunogen.</p>

<p>EFTUD2 antibody was raised in Rabbit using Human EFTUD2 as the immunogen</p>

<p>The FHL1 antibody is a cytotoxic monoclonal antibody that acts as a family kinase inhibitor. It targets tyrosine residues and neutralizes chemokines, including TNF-α. This antibody has been shown to have high affinity for collagen and can effectively block the activity of antibodies that are involved in superoxide production. Additionally, the FHL1 antibody has been found to be highly reactive with liver microsomes, making it a valuable tool for studying liver function. With its potent inhibitory properties and specificity, the FHL1 antibody is an essential tool for researchers in the field of immunology.</p>

<p>SMAD3 antibody was raised in Mouse using a purified recombinant fragment of human SMAD3 expressed in E. coli as the immunogen.</p>

<p>MAGEB3 antibody was raised using the N terminal of MAGEB3 corresponding to a region with amino acids KKKVSFSSPLILGATIQKKSAGRSRSALKKPQRALSTTTSVDVSYKKSYK</p>

<p>Rabbit polyclonal EWS antibody</p>

<p>RARRES3 antibody was raised using a synthetic peptide corresponding to a region with amino acids FSVLSNSAEVKRERLEDVVGGCCYRVNNSLDHEYQPRPVEVIISSAKEMV</p>

<p>Rabbit polyclonal CKMT2 antibody</p>

<p>Purified Rabbit polyclonal MPK7 antibody</p>

<p>Mouse monoclonal SCYL3 antibody</p>

<p>The BHMT antibody is a monoclonal antibody that specifically targets CD33, a receptor protein expressed on the surface of certain cells. This antibody is widely used in Life Sciences research and immunoassays to detect and study CD33-related processes. The BHMT antibody has a high affinity for CD33 due to its unique binding site, which allows for accurate and reliable detection. It can be used in various applications such as flow cytometry, immunohistochemistry, and Western blotting. Additionally, this antibody has been utilized in studies investigating collagen synthesis, disulfide bond formation, glucagon signaling, TNF-α inhibition, and the presence of autoantibodies. With its exceptional specificity and sensitivity, the BHMT antibody is an invaluable tool for researchers studying CD33-related pathways and diseases.</p>

<p>NARS antibody was raised in Rabbit using Human NARS as the immunogen</p>

<p>Rabbit polyclonal TSEN2 antibody</p>

<p>Rabbit polyclonal SENP2 antibody</p>

<p>The DTNB antibody is a highly specialized product in the field of Life Sciences. It belongs to the group of chemokine antibodies and is widely used in various immunoassays. This antibody specifically targets a specific molecule and can be used for the detection and quantification of this target in samples.</p>

<p>Rabbit polyclonal GPI antibody (HRP)</p>

<p>Purified Polyclonal Profilin 2 antibody</p>

<p>EFEMP1 antibody was raised using the middle region of EFEMP1 corresponding to a region with amino acids NENGEFYLRQTSPVSAMLVLVKSLSGPREHIVDLEMLTVSSIGTFRTSSV</p>

<p>The POT1 antibody is a polyclonal antibody that specifically targets brain natriuretic peptide (BNP). It belongs to the class of antibodies known as neutralizing antibodies and is widely used in life sciences research. The POT1 antibody is derived from globulin and has high affinity for BNP, making it an effective tool for studying the function and regulation of this peptide.</p>

<p>DEF6 antibody was raised in Rabbit using Human DEF6 as the immunogen</p>