Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,566 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(736 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75323 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
USP16 antibody
<p>USP16 antibody was raised using the N terminal of USP16 corresponding to a region with amino acids CKTDNKVKDKAEEETEEKPSVWLCLKCGHQGCGRNSQEQHALKHYLTPRS</p>IL3 antibody
<p>The IL3 antibody is a receptor molecule that has neutralizing properties. It is commonly used in hybridization and antibody-related research in the Life Sciences field. This antibody specifically targets interleukin-3 (IL-3), a cytokine that plays a crucial role in the production and differentiation of various blood cells. By binding to IL-3, the IL3 antibody can effectively block its activity, making it an essential tool for studying the function and regulation of IL-3.</p>JAK2 antibody
<p>The JAK2 antibody is a monoclonal antibody that specifically targets the Janus kinase 2 (JAK2) protein. This protein plays a crucial role in cell signaling and is involved in various biological processes, including chemokine signaling, epidermal growth factor receptor activation, and collagen synthesis.</p>BMP6 antibody
<p>The BMP6 antibody is a highly specialized collagen-based polyclonal antibody that targets the tyrosine residues in BMP6. This antibody is widely used in life sciences research to study the role of BMP6 in various biological processes. It has been shown to interact with multiple proteins, including plasminogen activator receptor, urokinase plasminogen activator, and alpha-fetoprotein. The BMP6 antibody is available as both a monoclonal and polyclonal antibody, offering researchers flexibility in their experimental design. This antibody has potential therapeutic applications, particularly in the treatment of thrombocytopenia and as a growth factor for tissue repair. Additionally, it has been found to have interactions with hyaluronic acid, further expanding its potential applications in regenerative medicine.</p>CD16 antibody
<p>CD16 antibody was raised in rat using murine CD16/32 (CD16/Fc gamma II and CD32/Fc gamma III receptors)</p>KCNQ1 antibody
<p>KCNQ1 antibody was raised using the N terminal of KCNQ1 corresponding to a region with amino acids RSKYVGLWGRLRFARKPISIIDLIVVVASMVVLCVGSKGQVFATSAIRGI</p>C6ORF182 antibody
<p>C6ORF182 antibody was raised using the middle region of C6Orf182 corresponding to a region with amino acids DIECELECLLKKMEIKGEQISKLKKHQDSVCKLQQKVQNSKMSEASGIQQ</p>TNF α antibody
TNF alpha antibody was raised in Mouse using recombinant Human TNF-alpha (BioSource company, Cat.No. PHC3013) as the immunogen.PICP antibody
<p>The PICP antibody is a highly specialized monoclonal antibody that targets the calpastatin protein. Calpastatin is an important regulator of calpain, a calcium-dependent protease involved in various cellular processes. The PICP antibody specifically inhibits the activity of calpastatin, thereby allowing for the activation of calpain.</p>YTHDF3 antibody
<p>YTHDF3 antibody was raised using the N terminal of YTHDF3 corresponding to a region with amino acids QPGALGNTPPFLGQHGFNFFPGNADFSTWGTSGSQGQSTQSSAYSSSYGY</p>BRAF antibody
<p>The BRAF antibody is a neuroprotective globulin that belongs to the class of glycosylated monoclonal antibodies. It has been specifically designed to target and inhibit the activity of BRAF, a protein involved in various cellular processes. This antibody has shown inhibitory effects on factors such as alpha-fetoprotein and chemokines, making it a valuable tool for researchers in the field of Life Sciences. The BRAF antibody is available in both polyclonal and monoclonal forms, providing options for different experimental needs. It is formulated with excipients to ensure stability and efficacy. Additionally, this antibody has neutralizing properties against IFN-gamma, further expanding its potential applications. With its unique characteristics and versatile nature, the BRAF antibody offers promising opportunities for scientific investigations and therapeutic developments.</p>ATP6V1A antibody
<p>ATP6V1A antibody was raised using the N terminal of ATP6V1A corresponding to a region with amino acids SGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQTQSIYIPR</p>GOPC antibody
<p>GOPC antibody was raised using the N terminal of GOPC corresponding to a region with amino acids EVLEKEFDKAFVDVDLLLGEIDPDQADITYEGRQKMTSLSSCFAQLCHKA</p>Calmodulin antibody
<p>The Calmodulin antibody is a highly specialized monoclonal antibody that targets and binds to calmodulin, a calcium-binding protein involved in various cellular processes. This antibody is widely used in Life Sciences research and is an essential tool for studying the functions of calmodulin in different biological systems.</p>CCR5 antibody
<p>The CCR5 antibody is a highly effective polyclonal antibody that targets the CCR5 chemokine receptor. This receptor plays a crucial role in various immune responses and has been linked to several diseases, including HIV/AIDS. The CCR5 antibody works by binding to the receptor and blocking its activity, thereby inhibiting the entry of HIV into cells.</p>NPY1R antibody
<p>Rabbit polyclonal NPY1R antibody, detects endougenous levels, cross reactive mouse, rat</p>AC antibody
<p>AC antibody was raised using the N terminal Of Ac corresponding to a region with amino acids FNGPSVIRRNARERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGA</p>AURKA antibody
<p>The AURKA antibody is a highly specialized product in the field of Life Sciences. It is an essential tool for researchers working with human serum and studying the effects of red ginseng on various cellular processes. This monoclonal antibody specifically targets and binds to AURKA, a protein that plays a crucial role in granulosa cell function.</p>BRAF antibody
<p>The BRAF antibody is a powerful tool in the field of Life Sciences. It is an inhibitor that specifically targets BRAF, a protein involved in cell growth and division. This antibody has been extensively studied for its potential therapeutic applications in various diseases, including cancer.</p>CTTN antibody
<p>The CTTN antibody is a monoclonal antibody that specifically targets and binds to CTTN (Cortactin) protein. Cortactin is a regulator of actin cytoskeleton dynamics and plays a crucial role in cell migration, adhesion, and invasion. This antibody is widely used in life sciences research to study the function and localization of CTTN in various cellular processes.</p>RORA antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. This drug has been extensively studied using advanced techniques like the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>BTN3A2 antibody
<p>The BTN3A2 antibody is a monoclonal antibody that is widely used in the field of Life Sciences. It specifically targets the BTN3A2 protein, which plays a crucial role in various biological processes. This antibody has been extensively studied and proven to be highly specific and sensitive in detecting the presence of BTN3A2.</p>MUC1 antibody
<p>The MUC1 antibody is a highly specialized monoclonal antibody that targets the glycoprotein MUC1. This glycoprotein plays a crucial role in cell signaling and immune response regulation. The MUC1 antibody specifically recognizes and binds to the glycan portion of MUC1, allowing for the detection and analysis of this protein in various biological samples.</p>NKD1 antibody
<p>NKD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELVGDVLRDTLSEEEEDDFRLEVALPPEKTDGLGSGDEKKMERVSEPCPG</p>Desmoglein 3 antibody
<p>Desmoglein 3 antibody was raised in mouse using recombinant human polypeptide Desmoglein 3 as the immunogen.</p>CD46 antibody
<p>CD46 antibody is a monoclonal antibody that specifically targets CD46, a protein involved in immune regulation. This antibody has neutralizing properties and can inhibit the activity of CD46, thereby modulating immune responses. CD46 antibody is commonly used in research and diagnostic applications to study the role of CD46 in various biological processes. It can be used in combination with other antibodies or proteins, such as c-myc or streptavidin, to facilitate detection or functional studies. CD46 antibody is formulated with excipients to ensure stability and can be used in various experimental techniques, including immunohistochemistry, flow cytometry, and western blotting. Its application extends beyond basic research to fields like Life Sciences and medical research where it may have implications for conditions like leukemia and epidermal growth factor-related disorders.</p>IL10 antibody
IL10 antibody was raised in mouse using highly pure recombinant human IL-10 as the immunogen.BTN1A1 antibody
<p>The BTN1A1 antibody is a monoclonal antibody that specifically targets the BTN1A1 protein. It is commonly used in Life Sciences research and has a wide range of applications. This antibody can be used as an inhibitor to study the function of the BTN1A1 protein in various cellular processes. It is also widely used in immunoassays to detect and quantify the presence of BTN1A1 in samples such as human serum. The BTN1A1 antibody has shown cytotoxic activity against cells expressing high levels of BTN1A1, making it a potential therapeutic option for diseases associated with abnormal BTN1A1 expression. Additionally, this antibody can be used in combination with other monoclonal antibodies, such as anti-DNP antibodies or anti-HER2 antibodies, to enhance their efficacy and target specific signaling pathways involving growth factors like epidermal growth factor (EGF).</p>PLAT antibody
<p>PLAT antibody was raised using the middle region of PLAT corresponding to a region with amino acids TVILGRTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDNDIALLQLKSDSSR</p>PGM5 antibody
<p>PGM5 antibody was raised in rabbit using the N terminal of PGM5 as the immunogen</p>FGFR1 antibody
FGFR1 antibody was raised in Mouse using purified recombinant extracellular fragment of human FGFR1(aa33-423) fused with hIgGFc tag expressed in HEK293 cells as the immunogen.NAGS antibody
<p>NAGS antibody was raised using the C terminal of NAGS corresponding to a region with amino acids YLDKFVVSSSRQGQGSGQMLWECLRRDLQTLFWRSRVTNPINPWYFKHSD</p>PLOD3 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an exceptional antituberculosis drug that falls under the class of rifamycins. With its bactericidal activity and potent ability to inhibit bacterial growth, it is considered one of the most effective treatments for tuberculosis infections. This active compound works by binding to DNA-dependent RNA polymerase, preventing transcription and replication. The high frequency of human activity has been demonstrated using a patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, this drug specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting cell growth in culture.DLG4 antibody
<p>DLG4 antibody was raised using a synthetic peptide corresponding to a region with amino acids AAHLHPIAIFIRPRSLENVLEINKRITEEQARKAFDRATKLEQEFTECFS</p>RanBP1 antibody
RanBP1 antibody was raised using the C terminal of RANBP1 corresponding to a region with amino acids KFEECRKEIEEREKKAGSGKNDHAEKVAEKLEALSVKEETKEDAEEKQCDK2 antibody
<p>The CDK2 antibody is a monoclonal antibody that belongs to the family of kinase inhibitors. It is used in Life Sciences research to study the growth factor signaling pathways and their role in various cellular processes. The CDK2 antibody specifically targets and neutralizes the activity of cyclin-dependent kinase 2 (CDK2), an enzyme involved in cell cycle regulation. By inhibiting CDK2, this antibody can block the proliferation of cancer cells and other cell types.</p>Crystallin Zeta antibody
<p>Crystallin Zeta antibody was raised using a synthetic peptide corresponding to a region with amino acids KGIDIIIEMLANVNLSKDLSLLSHGGRVIVVGSRGTIEINPRDTMAKESS</p>PDCD8 antibody
<p>PDCD8 antibody was raised in rabbit using the N terminal of PDCD8 as the immunogen</p>PIK3CA antibody
<p>The PIK3CA antibody is a polyclonal antibody that targets the PIK3CA gene, which encodes the p110α subunit of phosphatidylinositol 3-kinase (PI3K). This antibody is commonly used in life sciences research to study the role of PIK3CA in various cellular processes. It has been shown to inhibit protease activity and mitogen-activated protein kinase (MAPK) signaling pathway, both of which are involved in cell proliferation and survival. The PIK3CA antibody exhibits high substrate specificity for its target and has strong DNA binding activity. It is commonly used in flow immunoassays to detect activated PIK3CA in primary cells. Additionally, this antibody has neutralizing properties against interleukin-6 (IL-6), an inflammatory cytokine involved in various diseases. Whether you're studying signal transduction pathways or investigating therapeutic targets, the PIK3CA antibody is an essential tool for your research needs</p>LRRC50 antibody
<p>LRRC50 antibody was raised using the N terminal of LRRC50 corresponding to a region with amino acids LNDTLYLHFKGFDRIENLEEYTGLRCLWLQSNGIQKIENLEAQTELRCLF</p>SIX1 antibody
The SIX1 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the protein SIX1, which plays a crucial role in various biological processes, including development, cell growth, and differentiation. This antibody can be used to detect and quantify the levels of SIX1 in human serum samples or tissue sections.TMOD1 antibody
<p>The TMOD1 antibody is a compound that inhibits serotonin, adeno-associated virus, and heparin. It is commonly used in Life Sciences research and has been shown to inhibit the activity of heparin cofactor. This polyclonal antibody targets specific polypeptides and can be used in the development of new medicines. With its inhibiting properties, the TMOD1 antibody is a valuable tool for researchers studying various biological processes.</p>ASPH antibody
<p>ASPH antibody was raised using the N terminal of ASPH corresponding to a region with amino acids SEVLQGKLGIYDADGDGDFDVDDAKVLLEGPSGVAKRKTKAKVKELTKEE</p>LYK5 antibody
<p>LYK5 antibody was raised using the C terminal of LYK5 corresponding to a region with amino acids AEELTMSPSRSVANSGLSDSLTTSTPRPSNGDSPSHPYHRTFSPHFHHFV</p>Ku70 antibody
<p>The Ku70 antibody is a monoclonal antibody that specifically targets and activates β-catenin. This antibody has been shown to have antiangiogenic activity and can inhibit the growth of blood vessels in tumors. It is also used in research involving pluripotent stem cells, as it can act as an agent to enhance their differentiation potential. The Ku70 antibody has high affinity for collagen and can bind to endoplasmic reticulum aminopeptidase and phosphatase, leading to their modulation. It is reactive against a wide range of targets and exhibits low density, allowing for efficient endocytic uptake. This antibody is widely used in the Life Sciences field and is produced from a hybridoma cell line.</p>
