Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,566 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(736 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75323 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
APC antibody
<p>The APC antibody is a highly effective inhibitor used in the field of Life Sciences. It specifically targets nuclear factors and interleukins, neutralizing their activity. This drug antibody is available as both a monoclonal antibody and polyclonal antibodies, providing versatility in its application. The APC antibody is widely used as a medicament for various conditions, thanks to its ability to bind to specific target proteins. It is formulated in a buffered solution, ensuring stability and effectiveness. When activated, the APC antibody forms a monolayer on the surface of cells, allowing for precise binding interactions with target molecules. Whether you need to study protein-protein interactions or investigate signaling pathways, the APC antibody is an essential tool for any researcher in the Life Sciences field.</p>CTNNB1 antibody
<p>The CTNNB1 antibody is a monoclonal antibody that specifically targets the CTNNB1 protein. This protein plays a crucial role in various cellular processes, including cell adhesion, signal transduction, and gene expression. The CTNNB1 antibody has been extensively studied and shown to be highly specific and sensitive in detecting CTNNB1 in various biological samples.</p>RSV Antibody
The RSV Antibody is a highly effective monoclonal antibody that has been specifically designed to target and neutralize the Respiratory Syncytial Virus (RSV). This innovative antibody has been developed using state-of-the-art spectrometric techniques, ensuring its high purity and potency. It is a valuable tool in the field of Life Sciences and is widely used in research and diagnostic applications.ZC3H14 antibody
<p>ZC3H14 antibody was raised using the N terminal of ZC3H14 corresponding to a region with amino acids KFPSPPLPIFLPPEPVDLGSITSSSCSLNELDNISHLLRKISADINEIKG</p>DCXR antibody
<p>DCXR antibody was raised using the middle region of DCXR corresponding to a region with amino acids STKGALDMLTKVMALELGPHKIRVNAVNPTVVMTSMGQATWSDPHKAKTM</p>HNRNPUL1 antibody
<p>HNRNPUL1 antibody was raised in Rabbit using Human HNRNPUL1 as the immunogen</p>RAD54 antibody
<p>The RAD54 antibody is a potent antitumor agent that binds to specific receptors on tumor cells, leading to their destruction. It has been shown to have strong cytotoxic effects and can induce cell death in a targeted manner. The antibody's antigen binding domain specifically recognizes and binds to certain molecules present on tumor cells, triggering an immune response against them. This monoclonal antibody, developed in the field of Life Sciences, contains specific amino acid residues that enhance its efficacy and specificity. In preclinical studies, the RAD54 antibody has demonstrated the ability to inhibit angiogenesis by reducing microvessel density and suppressing endothelial growth factors. Its potential applications in cancer therapy make it a promising candidate for further research and development.</p>Perforin antibody (biotin)
Perforin antibody (biotin) was raised in mouse using purified granules from human YT lymphoma cell line as the immunogen.PIAS1 antibody
<p>The PIAS1 antibody is a highly specialized protein used in Life Sciences. It belongs to the class of monoclonal antibodies and polyclonal antibodies that are widely used in research and medical applications. This antibody specifically targets adalimumab, a medication used to treat conditions related to tumor necrosis factor-α (TNF-α) such as rheumatoid arthritis and Crohn's disease.</p>MTMR12 antibody
MTMR12 antibody was raised using the middle region of MTMR12 corresponding to a region with amino acids RNSARLSSLFPFALLQRHSSKPVLPTSGWKALGDEDDLAKREDEFVDLGDTWIST antibody
<p>The TWIST antibody is a growth factor that is commonly used in immunoassays and research in the field of Life Sciences. It belongs to the category of Polyclonal Antibodies and specifically targets epidermal growth factor (EGF). The TWIST antibody has been extensively studied and its binding characteristics have been analyzed using molecular docking techniques. It has been found to interact with cations, such as human serum albumin, and fatty acids. This antibody is widely used in various applications, including the detection and quantification of specific proteins in biological samples, as well as in studies involving serum albumin. Both monoclonal and polyclonal versions of the TWIST antibody are available, providing researchers with options depending on their specific experimental needs.</p>CRYAB antibody
<p>The CRYAB antibody is a highly effective tool for research in the field of Life Sciences. It is specifically designed to target and bind to CRYAB, a protein that plays a crucial role in various cellular processes. This antibody can be used to study the activation of CRYAB in response to different stimuli, as well as its interactions with other proteins and molecules.</p>beta 2 Microglobulin antibody
<p>The beta 2 Microglobulin antibody is a mouse monoclonal antibody that specifically targets and binds to beta 2 Microglobulin, a protein found on the surface of cells. This antibody is widely used in Life Sciences research for various applications, including antigen-antibody reactions, inhibition curves, and neutralizing assays.</p>PNMA3 antibody
<p>PNMA3 antibody was raised using the N terminal of PNMA3 corresponding to a region with amino acids QDIDYALLPREIPGKGGPWEVIVKPRNSDGEFLNRLNRFLEEERRTVSDM</p>NGAL antibody
<p>The NGAL antibody is a monoclonal antibody that specifically targets neutrophil gelatinase-associated lipocalin (NGAL). NGAL is an important biomarker in various Life Sciences research areas and has been implicated in several pathological conditions. This antibody recognizes NGAL through its unique binding sites and can be used for various applications, including immunohistochemistry, ELISA, Western blotting, and flow cytometry.</p>MIF antibody
<p>MIF antibody is a monoclonal antibody that has anticoagulant properties. It belongs to the group of antibodies known as cytotoxic antibodies. This antibody specifically targets and neutralizes the inhibitory factor known as MIF (Migration Inhibitory Factor). MIF is a protein involved in various biological processes, including immune response and inflammation. The MIF antibody can bind to MIF and prevent its activity, which may have therapeutic implications in certain diseases.</p>C6 antibody
<p>The C6 antibody is a highly activated protein that acts as an inhibitor of tumor necrosis factor-alpha (TNF-α). It is widely used in Life Sciences research for its ability to target and neutralize TNF-α, a key player in inflammation and immune response. The C6 antibody has shown promising results in various studies, including its ability to inhibit the binding of TNF-α to its receptors and reduce the production of inflammatory mediators.</p>ADHFE1 antibody
<p>ADHFE1 antibody was raised using the middle region of ADHFE1 corresponding to a region with amino acids RIVAKYLKRAVRNPDDLEARSHMHLASAFAGIGFGNAGVHLCHGMSYPIS</p>EDC4 antibody
<p>EDC4 antibody was raised using the N terminal of EDC4 corresponding to a region with amino acids LQEKQVICLSGDDSSTCIGILAKEVEIVASSDSSISSKARGSNKVKIQPV</p>Fibrinogen Alpha antibody
<p>Fibrinogen Alpha antibody was raised using the N terminal of FGA corresponding to a region with amino acids MFSMRIVCLVLSVVGTAWTADSGEGDFLAEGGGVRGPRVVERHQSACKDS</p>BCL7A antibody
<p>BCL7A antibody was raised using the middle region of BCL7A corresponding to a region with amino acids CGSEVTTPENSSSPGMMDMHDDNSNQSSIADASPIKQENSSNSSPAPEPN</p>THC antibody
<p>THC antibody was raised in mouse using Tetrahydrocannabinol (THC)-BSA as the immunogen.</p>CER1 antibody
<p>CER1 antibody was raised in Mouse using a purified recombinant fragment of human CER1 expressed in E. coli as the immunogen.</p>SMAD2 antibody
The SMAD2 antibody is a highly effective tool in the field of Life Sciences. It is an antibody that specifically targets SMAD2, a protein involved in various cellular processes. This antibody has been extensively studied and has shown to have potent protease activity, making it an ideal choice for researchers working on protease-related projects.NOB1 antibody
<p>NOB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LPTPKGGKYAINPHLTEDQRFPQLRLSQKARQKTNVFAPDYIAGVSPFVE</p>CBFA2T2 antibody
<p>CBFA2T2 antibody was raised in mouse using recombinant Core-Binding Factor,Alpha Subunit 2</p>SOX11 antibody
<p>The SOX11 antibody is a highly specialized monoclonal antibody that has neutralizing properties. It is designed to target and bind to specific proteins, such as globulin, in order to inhibit their activity. This antibody has been extensively studied and proven effective in various applications.</p>ESRRG antibody
<p>ESRRG antibody was raised using the N terminal of ESRRG corresponding to a region with amino acids DRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSSTMNGHQN</p>APOM antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the rifamycin class. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. Through extensive research using transcription-quantitative polymerase chain and patch-clamp techniques, it has been proven to inhibit bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Additionally, this drug undergoes various metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. It also demonstrates a high affinity for markers expressed in Mycobacterium tuberculosis strains, inhibiting their cell growth. Experience the potent efficacy of 6-Fluoro-3-indoxyl-beta-D-galactopyranoside in combating tuberculosis infections.</p>DHX30 antibody
<p>DHX30 antibody was raised using a synthetic peptide corresponding to a region with amino acids AESGMAPGGPGEGDGSLVNASRDLLKEFPQPKNLLNSVIGRALGISHAKD</p>CD28 antibody
<p>The CD28 antibody is a monoclonal antibody that inhibits the activity of CD28, a protein found on the surface of activated T cells. This antibody has been widely used in life sciences research to study the role of CD28 in immune responses. It specifically binds to CD28 and prevents its interaction with other molecules such as dopamine and vasoactive intestinal peptide, thereby modulating T cell activation and function. The CD28 antibody is highly specific for human CD28 protein and has been shown to effectively block its activity in various experimental settings. It can be used in applications such as flow cytometry, immunohistochemistry, and Western blotting to detect and analyze CD28 expression levels. Additionally, this antibody has been used to investigate the presence of autoantibodies against CD28 in certain autoimmune diseases. Its high affinity for CD28 allows for efficient targeting and potential therapeutic applications in the future.</p>NANOS1 antibody
<p>NANOS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids DDDDDSDEPGSRGRYLGSALELRALELCAGPAEAGLLEERFAELSPFAGR</p>CATSPER2 antibody
<p>CATSPER2 antibody was raised using the N terminal of CATSPER2 corresponding to a region with amino acids HLQGLSQAVPRHTIRELLDPSRQKKLVLGDQHQLVRFSIKPQRIEQISHA</p>TTC9C antibody
<p>TTC9C antibody was raised using the N terminal of TTC9C corresponding to a region with amino acids MEKRLQEAQLYKEEGNQRYREGKYRDAVSRYHRALLQLRGLDPSLPSPLP</p>LMAN1 antibody
<p>LMAN1 antibody was raised using the middle region of LMAN1 corresponding to a region with amino acids DKKKEEFQKGHPDLQGQPAEEIFESVGDRELRQVFEGQNRIHLEIKQLNR</p>RPS19 antibody
<p>The RPS19 antibody is a highly effective inhibitor that targets tyrosine and nucleotide molecules. It works by blocking the growth factor, specifically the epidermal growth factor, which is essential for cell division and proliferation. This monoclonal antibody has been extensively studied in Life Sciences and has shown promising results in various research applications. It can be used in combination with other antibodies such as trastuzumab to enhance its therapeutic effects. The RPS19 antibody is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs. With its ability to target specific biomolecules, including the anti-HER2 antibody, this antibody offers great potential for nuclear research and other applications in the field of biomedicine.</p>SORCS2 antibody
<p>The SORCS2 antibody is a polyclonal antibody that specifically targets the endonuclease SORCS2. This antibody recognizes and binds to the sugar moieties on SORCS2, inhibiting its activity. SORCS2 is involved in various biological processes, including growth factor signaling and regulation of microvessel density. In Life Sciences research, this antibody is commonly used to study the role of SORCS2 in different cellular pathways. It has been shown to neutralize the effects of epidermal growth factor (EGF)-like molecules and hyaluronidase in human serum. Additionally, it has been found to modulate the activity of glutamate receptors and collagen synthesis. The SORCS2 antibody is a valuable tool for researchers studying the function and regulation of this important enzyme in both normal and disease states.</p>MHC Class II antibody
<p>The MHC Class II antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets and neutralizes MHC Class II molecules. These molecules play a crucial role in the immune response by presenting antigens to T cells, thereby initiating an immune response. The MHC Class II antibody can be used in various applications such as immunohistochemistry, flow cytometry, and Western blotting. It has been shown to effectively stain actin filaments, growth factors, collagen, glycoproteins, fibrinogen, and other cellular components. Additionally, this antibody has been used to study the role of MHC Class II molecules in various biological processes including antigen presentation and cytokine production. Its high specificity and affinity make it an essential tool for researchers studying immune responses and related diseases.</p>anti-Sheep IgM Antibody
Purified Mouse anti-Dog/Canine IgM (mu chain specific) Monoclonal AntibodyPurity:Min. 95%CD3 antibody (biotin)
<p>CD3 antibody (biotin) was raised in mouse using chicken CD3 as the immunoge.</p>PPP3CC antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth by preventing transcription and replication. Its efficacy has been demonstrated through various scientific techniques, including the patch-clamp technique on human erythrocytes. This active compound undergoes several metabolic transformations, such as hydrolysis, oxidation, reduction, and conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.GALR2 antibody
<p>The GALR2 antibody is a highly effective monoclonal antibody that specifically targets the GALR2 receptor. This antibody has been extensively studied and proven to have exceptional binding affinity and specificity. It can be used in various applications, including immunohistochemistry, western blotting, and flow cytometry.</p>SASP antibody
<p>SASP antibody was raised using the middle region of Sasp corresponding to a region with amino acids RGEALGVYNRLSPQDQGDYGTVKEALLKAFGVPGAAPSHLPKEIVFANSM</p>
