Primary Antibodies

CDY1 antibody was raised using the C terminal of CDY1 corresponding to a region with amino acids  FPRTWWQSAEDVHREKIQLDLEAEFYFTHLIVMFKSPRPAAMVLDRSQDF

The XRCC4 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the XRCC4 protein, which plays a crucial role in DNA repair and recombination. The antibody binds to the histidine-tagged XRCC4 protein, allowing for its detection and analysis in various experimental settings. This XRCC4 antibody is commonly used in studies involving pluripotent cells, collagen synthesis, lipoprotein lipase regulation, and immune response modulation. Additionally, it has been shown to interact with other proteins such as interferon, TGF-beta, and endothelial growth factors. The XRCC4 antibody offers researchers a valuable tool for investigating DNA repair mechanisms and understanding their implications in various biological processes.

Rabbit polyclonal Prostacyclin Receptor antibody

LGALS14 antibody was raised using the N terminal of LGALS14 corresponding to a region with amino acids MSSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDI

The Histone H2Ax antibody is a highly specialized monoclonal antibody used in Life Sciences research. This antibody specifically targets and binds to the acidic histone protein H2Ax, which plays a crucial role in DNA repair and damage response. By detecting the presence of H2Ax, researchers can gain valuable insights into various cellular processes, including fibrinogen activation, growth factor signaling, and multidrug resistance.

Rabbit polyclonal LATH antibody

Purified Polyclonal ENT1 antibody

Thyroid Peroxidase antibody is a monoclonal antibody used in Life Sciences research. It targets the thyroid peroxidase enzyme, which plays a crucial role in thyroid hormone synthesis. This antibody can be used to study the regulation and function of thyroid peroxidase, as well as its involvement in autoimmune thyroid diseases. Additionally, Thyroid Peroxidase antibody has been shown to have growth factor-like activity and can activate various signaling pathways. It has also been found to be involved in the glycosylation of proteins, including fibrinogen. Furthermore, this antibody has potential diagnostic applications as it can detect autoantibodies against thyroid peroxidase, which are often present in patients with autoimmune thyroid disorders. Overall, Thyroid Peroxidase antibody is a valuable tool for researchers studying thyroid biology and related diseases.

Affinity purified Rabbit polyclonal FASTKD1 antibody

Rabbit polyclonal CRGF antibody

GATM antibody was raised in Rabbit using Human GATM as the immunogen

Affinity purified Rabbit polyclonal TRADD antibody

The GPR120 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It acts as a growth factor and has the ability to neutralize epidermal growth factor (EGF) and TGF-beta. This antibody is widely used in research laboratories and pharmaceutical companies for its inhibitory properties. It specifically targets GPR120, a receptor protein that plays a crucial role in fatty acid metabolism. The GPR120 antibody can be used to study the activation of this receptor and its downstream signaling pathways. Additionally, it has been proven effective in detecting c-myc expression and alpha-fetoprotein levels. With its high specificity and reliability, the GPR120 antibody is an essential tool for researchers working in various fields of study within Life Sciences.

Rabbit polyclonal Kininogen 1 antibody

Rabbit polyclonal AKAP14 antibody

The p53 antibody is a highly effective inhibitor used in Life Sciences research. This monoclonal antibody specifically targets and neutralizes the p53 protein, which plays a crucial role in regulating cell growth and preventing tumor formation. By blocking the activity of p53, this antibody can be used to study the molecular mechanisms involved in cell cycle control, DNA repair, and apoptosis. Additionally, it has been shown to enhance the cytotoxic effects of certain chemotherapeutic agents and interferon. With its high specificity and potency, the p53 antibody is a valuable tool for studying the function of this important tumor suppressor protein.

Rabbit polyclonal OR52A4 antibody

DHRS4 antibody was raised in Rabbit using Human DHRS4 as the immunogen

Rabbit polyclonal p44 MAPK antibody

Affinity purified Rabbit polyclonal RBM15 antibody

Affinity purified Rabbit polyclonal Syntrophin alpha 1 antibody

RIPK2 antibody was raised in rabbit using the middle region of RIPK2 as the immunogen

DOK7 antibody was raised in rabbit using the C terminal of DOK7 as the immunogen

RORA antibody was raised using the N terminal of RORA corresponding to a region with amino acids TPTPAGEGARRDELFGILQILHQCILSSGDAFVLTGVCCSWRQNGKPPYS

Affinity purified Rabbit polyclonal TNFAP1 antibody

CLIC4 antibody was raised using the N terminal of CLIC4 corresponding to a region with amino acids LSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVF

The PSPH antibody is a monoclonal antibody produced by a hybridoma cell strain. It is designed to specifically target and bind to the PSPH protein, which plays a crucial role in various biological processes. The antibody can be used in life sciences research, diagnostic assays, and therapeutic applications.

The CD66b antibody is a monoclonal antibody that has a stimulatory effect on epidermal growth factor (EGF) signaling. It binds to the CD66b antigen, which is expressed on activated immune cells. This binding leads to the dephosphorylation of EGF receptors and enhances their signaling activity. The CD66b antibody can be used in various life science applications, such as immunohistochemistry, flow cytometry, and Western blotting. It can also be used for hybridization studies and to detect autoantibodies. Additionally, the CD66b antibody can be conjugated with other molecules, such as enzymes or fluorescent dyes, to facilitate detection and visualization in experiments. Whether you're studying mitogen-activated protein (MAP) kinase pathways or investigating receptor binding and interferon signaling, the CD66b antibody is an essential tool for your research needs. Choose from a range of formats, including chimeric proteins and polyclonal antibodies, to

Affinity purified Rabbit polyclonal HUS1 antibody

WBSCR1 antibody was raised using the middle region of Wbscr1 corresponding to a region with amino acids DSRDDFNSGFRDDFLGGRGGSRPGDRRTGPPMGSRFRDGPPLRGSNMDFR

The FZD4 antibody is a highly specialized antibody that targets the FZD4 protein. This protein plays a crucial role in various cellular processes, including actin dynamics and signaling pathways involved in development and disease. The FZD4 antibody is available in both polyclonal and monoclonal forms, offering researchers the flexibility to choose the best option for their specific experiments.

TFPI antibody is a monoclonal antibody that targets tissue factor pathway inhibitor (TFPI), a protein involved in the regulation of blood clotting. TFPI antibody inhibits the activity of TFPI, which leads to increased blood clotting and reduced bleeding. This antibody has been shown to have anti-VEGF (vascular endothelial growth factor) properties, which may be beneficial in the treatment of diseases involving abnormal blood vessel growth, such as cancer and age-related macular degeneration. Additionally, TFPI antibody has been found to modulate hormone levels, including adipose and epidermal growth factors, which play important roles in various physiological processes. The use of TFPI antibody in Life Sciences research has also demonstrated its potential as a tool for studying the mechanisms of blood clotting and angiogenesis.

ANGPTL4 antibody was raised in Rabbit using Human Angptl4 as the immunogen

Rabbit polyclonal AXL antibody (Tyr691)

Serotonin transporter antibody was raised in mouse using at serotonin transporter, N-terminus/GST Fusion protein (amino acids 1-85) as the immunogen.

The SMAD antibody is a highly specific monoclonal antibody that targets the SMAD protein, an important regulator of cellular processes. This antibody is widely used in Life Sciences research to study various cellular pathways and signaling cascades. It specifically recognizes the nuclear localization of SMAD and inhibits its function by blocking its interaction with other proteins. The SMAD antibody has been extensively validated for use in immunohistochemistry, western blotting, and other molecular biology techniques. It is a valuable tool for researchers studying cell antigens, glycosylation, exocytosis, and phosphatase activity. Whether you are investigating the role of SMAD in cancer development or studying the effects of interleukin-6 on cellular processes, the SMAD antibody is an essential component of your research toolkit. Choose this high-quality polyclonal antibody to ensure accurate and reliable results in your experiments.

MLXIP antibody was raised in Rabbit using Human MLXIP as the immunogen

Affinity purified Rabbit polyclonal Galanin Receptor 2 antibody

ENOPH1 antibody was raised using the N terminal of ENOPH1 corresponding to a region with amino acids IEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASGNGVD

The RARG antibody is a monoclonal antibody that targets the retinoic acid receptor gamma (RARG). It belongs to the family of tyrosine kinase inhibitors and acts as a cytotoxic agent by inhibiting the growth of endothelial cells. This antibody has been extensively studied in Life Sciences research and has shown promising results in neutralizing the effects of growth factors such as trastuzumab and vascular endothelial growth factor (VEGF). Additionally, it has been found to have an inhibitory effect on tyrosinase, an enzyme involved in melanin production. The RARG antibody can be used in various applications, including immunohistochemistry, western blotting, and ELISA assays. With its potential therapeutic applications, this antibody is a valuable tool for researchers and clinicians alike.

Affinity purified Rabbit polyclonal C20orf11 antibody

HCN3 antibody was raised in Rabbit using Human HCN3 as the immunogen

Complement C1q antibody was raised in mouse using human complement C1q as the immunogen.

Affinity purified Mouse polyclonal GBP1 antibody

Affinity purified Rabbit polyclonal FIG4 antibody

ARHGAP15 antibody was raised in Rabbit using Human ARHGAP15 as the immunogen

The beta Galactosidase antibody is a powerful tool used in various research applications. This antibody is commonly used in fluorescent immunohistochemistry to detect the presence and localization of beta-Galactosidase in tissues and cells. It can also be used for the detection of beta-Galactosidase activity in nuclear extracts.

Affinity purified Rabbit polyclonal BZW2 antibody

CDC42EP4 antibody was raised in Rabbit using Human CDC42EP4 as the immunogen

Rabbit polyclonal PRKDC antibody

Rabbit polyclonal PCYT1B antibody

The PCBP2 antibody is a highly specialized Polyclonal Antibody that has neutralizing properties against enzyme activities. It is commonly used in flow immunoassay techniques to detect and quantify the presence of inhibitory factors in primary cells. This antibody specifically targets the cytokine family, particularly interleukin-6, which plays a crucial role in immune response regulation. The PCBP2 antibody is also effective in inhibiting protease activity and interferon signaling pathways. Its high substrate specificity and strong DNA binding activity make it a valuable tool for researchers studying various cellular processes and molecular interactions. With its exceptional performance and reliability, the PCBP2 antibody is an essential component in any immunological research project.

Affinity purified Rabbit polyclonal RPS10 antibody

The Nkx2.5 antibody is a powerful tool used in life sciences research. It is a polyclonal antibody that specifically targets the Nkx2.5 protein, which plays a crucial role in heart development and function. This antibody has been extensively tested and proven to be highly effective in various applications.

ARHGAP26 antibody was raised in Rabbit using Human ARHGAP26 as the immunogen

Rabbit polyclonal Cortactin antibody (Tyr421)

ATXN7L1 antibody was raised using the middle region of ATXN7L1 corresponding to a region with amino acids KVPSPEAFLGKPWSSWIDAAKLHCSDNVDLEEAGKEGGKSREVMRLNKED

Rabbit polyclonal TRA2 alpha antibody

GTF2F2 antibody was raised in Rabbit using Human GTF2F2 as the immunogen

The CXCR2 antibody is a highly effective tool used in the field of life sciences. It is a glycoprotein that specifically targets and binds to the CXCR2 receptor, which plays a crucial role in various cellular processes such as endothelial growth and chemokine signaling. This antibody is widely used in research settings to study the function of CXCR2 and its involvement in different biological pathways.

E2F8 antibody was raised in Rabbit using Human E2F8 as the immunogen

Affinity purified Rabbit polyclonal PITPN antibody

The MBP antibody is a highly specialized peptide agent that has catalase activity. It acts as an anticoagulant and is commonly used in various research applications in the Life Sciences field. This antibody specifically targets and binds to myelin basic protein (MBP), a key component of the myelin sheath that surrounds nerve fibers. By binding to MBP, this antibody can be used for the detection and quantification of MBP in various biological samples, such as human serum or tissue extracts.

The CD40 antibody is a monoclonal antibody that plays a crucial role in the field of Life Sciences. It is used in various immunoassays to detect the presence of CD40, a protein that is involved in immune responses. This antibody specifically targets CD40 and binds to it, allowing for accurate detection and quantification. The CD40 antibody has been extensively studied and proven to be highly effective in detecting CD40 in human serum samples. Additionally, it has shown promising results in inhibiting the activity of specific enzymes, such as phosphatases and fatty acids, which are involved in various cellular processes. Furthermore, this antibody has demonstrated antiviral properties by interfering with viral replication and inhibiting the growth of viruses. Overall, the CD40 antibody is a valuable tool for researchers and scientists working in the field of immunology and virology.

Rabbit polyclonal KCNC1 antibody (Ser503)

AP3M2 antibody was raised in Rabbit using Human AP3M2 as the immunogen

The IL1b antibody is a monoclonal antibody that specifically targets IL-1β, a pro-inflammatory cytokine involved in various immune and inflammatory responses. This antibody binds to IL-1β and prevents its interaction with its receptors, thereby inhibiting the downstream signaling pathways that lead to inflammation.

The BAFF antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that specifically targets and neutralizes the activity of BAFF (B-cell activating factor), a protein involved in the activation and survival of B-cells. This antibody has been extensively tested and proven to be effective in blocking the activity of BAFF, thereby preventing the proliferation and differentiation of B-cells.

Rabbit polyclonal MKL1 antibody

Affinity purified Rabbit polyclonal SSX2 antibody

The Annexin VII antibody is a highly specialized antibody used in the field of Life Sciences. It has cytotoxic properties and acts as a growth factor, promoting cell proliferation and survival. This antibody is capable of neutralizing the activity of adipose lipase, an enzyme involved in the breakdown of fats. It belongs to the class of Polyclonal Antibodies, which are produced by multiple B-cell clones and recognize different epitopes on the target protein. The Annexin VII antibody also exhibits natriuretic effects and has been shown to be effective against multidrug-resistant bacteria. Additionally, it can be used as a monoclonal antibody for targeted therapy or as an antibiotic to inhibit the growth of lipoprotein lipase and triglyceride lipase, enzymes involved in lipid metabolism.

The STAT3 antibody is a highly effective tool for researchers in the field of Life Sciences. This polyclonal antibody specifically targets the STAT3 protein, which plays a crucial role in various cellular processes such as growth factor signaling and actin filament formation. By binding to STAT3, this antibody allows researchers to study its activation and function.

LOC728227 antibody was raised using the C terminal of LOC728227 corresponding to a region with amino acids  GAGGAKSRGGQKAASARVKKPRRRGGKKPGQAKSHGGREQKAAAAGCKKP

Rabbit polyclonal TPM1 antibody

Rabbit polyclonal JAK1 antibody (Tyr1022)

The NT3 antibody is a specific antibody that targets adeno-associated inhibitors. It is commonly used in pluripotent stem cell research to study the effects of dopamine and other neurotransmitters. This antibody can also be used in various assays, such as enzyme-linked immunosorbent assays (ELISAs) or Western blotting, to detect the presence of NT3 in samples. Additionally, it has been shown to have potential therapeutic applications in treating diseases related to autoantibodies or collagen disorders. The NT3 antibody has high specificity and sensitivity, making it a valuable tool for researchers and clinicians alike.

Affinity purified Rabbit polyclonal EML1 antibody

HPD antibody was raised in Rabbit using Human HPD as the immunogen

CYP4F12 antibody was raised in Rabbit using Human CYP4F12 as the immunogen

Goat anti-monkey IgG (biotin) was raised in goat using monkey IgG as the immunogen.

CD49d antibody (biotin) was raised in rat using the alpha-4 chain of the VLA-4 integrin heterodimer as the immunogen.

CD62L antibody (Allophycocyanin-CY7) was raised in rat using C3H/eb cloned murine B lymphoma 38C-13 as the immunogen.

C1QTNF4 antibody was raised using the middle region of C1QTNF4 corresponding to a region with amino acids DEQRRPGARRAASQSAMLQLDYGDTVWLRLHGAPQYALGAPGATFSGYLV

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.