Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75594 products of "Primary Antibodies"
FGF19 antibody
FGF19 antibody is a highly specialized drug antibody that targets fibroblast growth factor 19 (FGF19). FGF19 is a growth factor that plays a crucial role in regulating the metabolism of fatty acids. This antibody has been developed for use in antiestrogen therapy, as it can effectively block the activity of FGF19 and inhibit its effects on adipose tissue.
Connexin 43 antibody
The Connexin 43 antibody is a highly specialized antibody used in Life Sciences research. It targets the protein Connexin 43, which plays a crucial role in cell communication and signaling. This antibody is available in both polyclonal and monoclonal forms.
EPS8L1 antibody
EPS8L1 antibody was raised using the N terminal of EPS8L1 corresponding to a region with amino acids QRDRSPAAETPPLQRRPSVRAVISTVERGAGRGRPQAKPIPEAEEAQRPE
TNFSF9 antibody
The TNFSF9 antibody is a highly specialized product used in the field of Life Sciences. This monoclonal antibody is designed to target and neutralize TNFSF9, a growth factor involved in various biological processes. The antibody has been extensively modified to enhance its efficacy and specificity, including acid modifications and glycosylation.
NLK antibody
The NLK antibody is a powerful tool in the field of Life Sciences. This polyclonal antibody has neutralizing properties and is able to bind to various growth factors, including fibrinogen, collagen, and fibronectin. It has been extensively tested in human serum and has shown high affinity for alpha-fetoprotein and anti-mesothelin antibodies. The NLK antibody can be used in a variety of applications, such as immunohistochemistry, Western blotting, and ELISA assays. With its exceptional binding capacity and specificity, this antibody is an invaluable resource for researchers in the field. Whether you're studying cell signaling pathways or investigating protein-protein interactions, the NLK antibody will provide reliable results and contribute to the advancement of scientific knowledge.
TNFRSF18 antibody
TNFRSF18 antibody was raised in rabbit using the C terminal of TNFRSF18 as the immunogen
Troponin T antibody
The Troponin T antibody is an immunosuppressant that belongs to the group of polyclonal antibodies. It specifically targets calmodulin, a protein involved in muscle contraction and relaxation. This antibody is buffered and has neutralizing properties, making it highly effective in inhibiting the activity of calmodulin. In addition to its immunosuppressive effects, the Troponin T antibody has been shown to promote the growth of factors that regulate cell proliferation and differentiation. It also exhibits diuretic properties by enhancing the excretion of fluids from the body. This antibody is widely used in life sciences research, particularly in studies involving interleukin-6 and other cytokines. The Troponin T antibody is available as a monoclonal antibody, which ensures high specificity and affinity for its target antigen. Its versatility extends beyond research applications, as it can also be used for diagnostic purposes, such as detecting influenza hemagglutinin or monitoring signaling pathways involving PI3-kinase
BNP antibody
The BNP antibody is a monoclonal antibody that specifically targets brain natriuretic peptide (BNP). It is designed to neutralize the activity of BNP in human serum. The antibody can be used in various assays and tests, including electrode-based assays, to measure the levels of BNP. Brain natriuretic peptide is a hormone that is involved in regulating blood pressure and fluid balance. By targeting BNP, this antibody can help researchers and clinicians better understand its role in various physiological processes. Additionally, the BNP antibody may have potential therapeutic applications as an antibody-drug conjugate or as a tool for studying tissue transglutaminase and other membrane-spanning polypeptides. With its high specificity and affinity for BNP, this monoclonal antibody offers a valuable tool for research and diagnostic purposes.PP2A antibody
The PP2A antibody is a highly specialized electrode used for the detection and analysis of Polyclonal Antibodies. This antibody is specifically designed to target and bind to adipocyte markers, allowing for accurate identification and characterization of these cells. The PP2A antibody has been shown to be effective in detecting acidic glycosylation patterns on adipocytes, which play a crucial role in their function and metabolism. Additionally, this antibody has been found to modulate superoxide production in adipocytes, suggesting a potential therapeutic application in oxidative stress-related disorders. Furthermore, studies have shown that the PP2A antibody can enhance e-cadherin expression in adipocytes, promoting cellular adhesion and insulin sensitivity. With its high specificity and sensitivity, the PP2A antibody is an invaluable tool for researchers in the field of Life Sciences studying interferon signaling pathways, adipose tissue biology, fatty acid metabolism, and more.
GPR81 antibody
The GPR81 antibody is a powerful tool used in Life Sciences research. It is a polyclonal antibody that specifically targets GPR81, a receptor involved in various cellular processes. This antibody has been extensively validated through cytotoxic assays and transcription-polymerase chain reaction (PCR) experiments.
HE4 antibody
The HE4 antibody is a monoclonal antibody that specifically targets human serum. It is designed to inhibit the activity of dimers in the nuclear protein complex. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications. It has been found to be effective in inhibiting interleukin-6, a pro-inflammatory cytokine, as well as other antibodies involved in immune responses. Additionally, the HE4 antibody has been shown to activate creatine kinase, an enzyme involved in energy metabolism, and modulate chemokine signaling pathways. Its unique properties make it a valuable tool for researchers and scientists working in various fields of study.Factor VII antibody
Factor VII antibody is a polyclonal antibody that targets the activated form of factor VII, a surface glycoprotein involved in the coagulation cascade. This antibody has been widely used in life sciences research to study the role of factor VII in various physiological processes. It has been shown to inhibit factor VII activity and gluconeogenesis in vitro. Additionally, this antibody has been used as a tool in multi-agent chemotherapy studies to investigate its potential therapeutic effects. Factor VII antibody can be used in various applications such as immunoassays, electrophoresis, and Western blotting to detect and quantify factor VII levels in samples. Its high specificity and sensitivity make it an essential tool for researchers studying coagulation pathways and related disorders.
AKR1C1 antibody
AKR1C1 antibody was raised in mouse using recombinant human AKR1C1 (1-323aa) purified from E. coli as the immunogen.
HBsAg antibody
HBsAg antibody is a glycoprotein that plays a crucial role in the immune response against hepatitis B virus (HBV) infection. It has catalase activity and promotes endothelial growth, making it an essential factor in various physiological processes. Additionally, HBsAg antibody has been found to be associated with antiphospholipid antibodies, which are autoantibodies that target phospholipids and can lead to blood clotting disorders. Monoclonal antibodies targeting HBsAg have shown promising results in the treatment of HBV infection. These antibodies specifically bind to the surface antigen of the virus, preventing its attachment to host cells and neutralizing its infectivity. One example of such a monoclonal antibody is trastuzumab, which is also used in the treatment of HER2-positive breast cancer. Furthermore, HBsAg antibody has been implicated in regulating cell growth and proliferation through its interaction with growth factors such as epidermal growth factor (EGF). StudiesCDC2 antibody
The CDC2 antibody is a highly specialized antibody used in the field of Life Sciences. It is derived from blood monocytes and is available as both polyclonal and monoclonal antibodies. The CDC2 antibody is commonly used in research laboratories to study various cellular processes and pathways.
GAPDH antibody
The GAPDH antibody is a highly specialized monoclonal antibody used in Life Sciences research. It plays a crucial role in various applications such as immunoblotting, immunoprecipitation, and immunohistochemistry. This antibody specifically targets the glyceraldehyde-3-phosphate dehydrogenase (GAPDH) enzyme, which is involved in glycolysis and other metabolic pathways.
CSE1L antibody
The CSE1L antibody is a cytotoxic monoclonal antibody that targets the epidermal growth factor (EGF) receptor. It is widely used in life sciences research to study the role of EGF and its signaling pathways. This antibody specifically binds to the activated form of the EGF receptor, inhibiting its function and preventing downstream signaling events. The CSE1L antibody has been shown to be effective in blocking the growth and proliferation of cancer cells that overexpress the EGF receptor, making it a promising therapeutic candidate for cancer treatment. Additionally, this antibody can be used as a tool in various experimental techniques, such as immunohistochemistry and Western blotting, to detect and quantify EGF receptor expression levels in different cell types and tissues. With its high specificity and sensitivity, the CSE1L antibody is an invaluable resource for researchers studying EGF-related signaling pathways and their implications in various biological processes.
Insulin antibody
Insulin antibody is a specialized antibody that is used for the detection and measurement of insulin levels in various biological samples. It can be used in research, diagnostic, and clinical settings to study conditions such as hyperinsulinaemic hypoglycaemia or insulin resistance. This antibody is produced by antibody-secreting cells and can be obtained in both polyclonal and monoclonal forms. The polyclonal antibodies are derived from animals immunized with recombinant human insulin, while the monoclonal antibodies are generated through hybridoma technology. Insulin antibodies specifically bind to insulin molecules present in the sample, allowing for their detection and quantification. This enables researchers and healthcare professionals to accurately measure insulin levels in human serum or other biological fluids. The use of insulin antibodies offers a reliable and sensitive method for insulin detection. These antibodies have been extensively validated for their specificity and sensitivity, ensuring accurate results. They recognize specific epitopes on the insulin molecule, such as certain amino acid residues or the
PTHLH antibody
PTHLH antibody was raised using the middle region of PTHLH corresponding to a region with amino acids YKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLS
Factor IX antibody (biotin)
Factor IX antibody (biotin) was raised in goat using human Factor IX purified from plasma as the immunogen.
Interferon alpha Receptor 1 antibody
The Interferon alpha Receptor 1 antibody is a highly specialized polyclonal antibody that is used in immunoassays. This antibody specifically targets the Interferon alpha Receptor 1 protein, which plays a crucial role in the immune response. It can be used for various applications, including Western blotting, immunoprecipitation, and immunohistochemistry.
PAIP1 antibody
PAIP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EPTFYTSDGVPFTAADPDYQEKYQELLEREDFFPDYEENGTDLSGAGDPY
LHR antibody
The LHR antibody is a polyclonal antibody used in life sciences research. It specifically targets the luteinizing hormone receptor (LHR), which plays a crucial role in reproductive processes. This antibody is commonly used to study the interaction between LHR and various ligands, such as chemokines, on the microvascular endothelium. It can also be used in antigen-antibody reactions to detect the presence of LHR in different tissues or cell types. The LHR antibody is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific experimental needs. With its high specificity and sensitivity, this antibody is an invaluable tool for investigating the function and regulation of LHR in various biological contexts.
Collagen Type IV antibody (biotin)
Collagen type IV antibody (biotin) was raised in rabbit using collagen type IV from human and bovine placenta as the immunogen.
DDT antibody
DDT antibody is an activated phosphatase that belongs to the class of monoclonal antibodies. It is used in life sciences research for various applications, including immunohistochemistry, Western blotting, and ELISA. DDT antibody specifically binds to DDT (dichlorodiphenyltrichloroethane), a synthetic insecticide that was widely used in the past but has since been banned due to its harmful effects on the environment and human health. This antibody can be used to detect and neutralize DDT in samples such as human serum or environmental samples. It has high affinity and specificity for DDT and does not cross-react with other compounds. The DDT antibody is conjugated with a fluorescent or enzymatic tag, allowing for easy detection and quantification of DDT in various assays.
SGSH antibody
The SGSH antibody is a highly specialized antibody that targets sulfatase, an enzyme involved in the breakdown of complex molecules called glycosaminoglycans (GAGs). This antibody specifically recognizes and binds to the sulfatase nucleotide-binding site, inhibiting its activity.
KCTD13 antibody
KCTD13 antibody was raised using the N terminal of KCTD13 corresponding to a region with amino acids PGPAAYGLKPLTPNSKYVKLNVGGSLHYTTLRTLTGQDTMLKAMFSGRVE
BRCA2 antibody
The BRCA2 antibody is a highly specific monoclonal antibody that is used in Life Sciences research. It specifically targets the BRCA2 protein, which is involved in DNA repair and maintenance of genomic stability. This antibody can be used for various applications, including Western blotting, immunohistochemistry, and flow cytometry. It has been shown to have high affinity and specificity for the BRCA2 protein, making it a valuable tool for studying its function and regulation. Additionally, this antibody does not cross-react with other proteins such as transferrin, alpha-fetoprotein, collagen, or lipoprotein lipase, ensuring accurate and reliable results. Whether you are studying DNA repair mechanisms or investigating the role of BRCA2 in cancer development, this BRCA2 antibody will provide you with the precise and reliable data you need for your research.
TNFSF10 antibody
TNFSF10 antibody was raised in rabbit using the N terminal of TNFSF10 as the immunogen
THBS2 antibody
The THBS2 antibody is a powerful tool in the field of Life Sciences. This antibody specifically targets and binds to CD33, a receptor protein involved in various biological processes. It can be used for research purposes, such as studying receptor binding and identifying binding proteins. Additionally, the THBS2 antibody has applications in diagnostics and therapeutics.
Goat anti human IgG
Goat anti human IgG is a highly effective inhibitor that targets antibodies, specifically sorafenib, in human serum. It has been extensively studied and proven to be effective in various applications, including electrochemical impedance in Life Sciences and immunoassays. This inhibitor works by blocking the activity of phosphatase, preventing the dephosphorylation of target proteins. Additionally, it can be used as a solubilizing agent for monoclonal antibodies, ensuring their stability and functionality. Goat anti human IgG is commonly used in research laboratories and pharmaceutical industries due to its high specificity and reliability. With its ability to bind to glycoproteins and induce fas-mediated apoptosis, this product offers a wide range of possibilities for experimental studies and therapeutic applications.
Factor VII antibody (FITC)
Factor VII antibody (FITC) was raised in sheep using human Factor VII purified from plasma as the immunogen.HLADR antibody
The HLADR antibody is a highly specialized monoclonal antibody that is used in the field of Life Sciences. It is designed to specifically bind to the HLADR receptor, which plays a crucial role in immune system function. This antibody has been extensively tested and shown to have high affinity and specificity for its target.
TIMP1 antibody
The TIMP1 antibody is a highly specific and sensitive tool used in Life Sciences research. It is an antibody that specifically targets and binds to TIMP1, which stands for Tissue Inhibitor of Metalloproteinase 1. TIMP1 is a protein that plays a crucial role in regulating the activity of enzymes known as metalloproteinases, which are involved in various biological processes including tissue remodeling, angiogenesis, and cell migration.
Goat anti-Human IgG antibody
The Goat anti-Human IgG antibody is a powerful tool used in Life Sciences research. This monoclonal antibody specifically targets and neutralizes human IgG, making it an essential component for various applications.
SLC12A2 antibody
SLC12A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids IIAFEEIIEPYRLHEDDKEQDIADKMKEDEPWRITDNELELYKTKTYRQI
STK11 antibody
STK11 antibody was raised using the N terminal of STK11 corresponding to a region with amino acids TLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNE
Complement factor H antibody
The Complement factor H antibody is a highly specialized antibody that plays a crucial role in the regulation of the immune system. It binds to glutamate and other molecules to prevent excessive activation of the complement system, which can lead to inflammation and tissue damage. This antibody is widely used in life sciences research, particularly in studies related to insulin, lipoprotein lipase, and heparin-induced thrombocytopenia. It is also used as a diagnostic tool for detecting insulin antibodies and as a therapeutic agent for targeting growth factors such as trastuzumab and epidermal growth factor. With its high specificity and affinity for its target molecules, this monoclonal antibody is an essential component in many medicaments and has proven to be invaluable in various research applications.
EGF antibody
The EGF antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets and neutralizes the activity of epidermal growth factor (EGF), a key regulator of cell growth and division. This antibody has been extensively studied and proven to be highly effective in inhibiting the activity of EGF and its downstream signaling pathways.
BCOR antibody
The BCOR antibody is a monoclonal antibody that specifically targets the necrosis factor-related apoptosis-inducing protein. This antibody has been widely used in Life Sciences research to study various biological processes, including amyloid plaque formation and cell death pathways. The BCOR antibody exhibits high specificity and affinity for its target and has been extensively characterized for its binding properties. It is also serum albumin-binding, which allows for efficient delivery and distribution in vivo. This antibody can be used in a variety of applications, such as immunohistochemistry, Western blotting, and ELISA assays. Whether you are studying erythropoietin signaling or investigating growth factors involved in low-density lipoprotein metabolism, the BCOR antibody is an invaluable tool for your research needs. Choose this highly reliable and validated monoclonal antibody to ensure accurate and reproducible results in your experiments.
CtBP2 antibody
The CtBP2 antibody is a highly specific and sensitive tool used in life sciences research. It is a polyclonal antibody that specifically detects CtBP2, a protein involved in various cellular processes. This antibody has been extensively validated and shown to have high affinity and specificity for its target.
HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productCA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
