Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75562 products of "Primary Antibodies"
AURKA antibody
The AURKA antibody is a monoclonal antibody that targets glial fibrillary acidic protein (GFAP). It is commonly used in research and diagnostics to detect the presence of GFAP, which is an important marker for astrocytes. This antibody can be used in various applications, including immunohistochemistry, western blotting, and flow cytometry. Additionally, it has been shown to be effective in detecting amyloid plaques in Alzheimer's disease brain tissue. The AURKA antibody is also useful for studying the role of protein kinases in cellular processes, as it specifically targets Aurora kinase A (AURKA). It can be used as a tool to inhibit the activity of AURKA and study its downstream effects on cell division and proliferation. In summary, the AURKA antibody is a valuable tool for researchers in the life sciences field who are studying various aspects of cellular biology and disease mechanisms.
OR13C9 antibody
OR13C9 antibody was raised in rabbit using the middle region of OR13C9 as the immunogen
Purity:Min. 95%DLC1 antibody
DLC1 antibody was raised using the C terminal of DLC1 corresponding to a region with amino acids NLAVCLAPSLFHLNTLKRENSSPRVMQRKQSLGKPDQKDLNENLAATQGL
CD28 antibody (PE)
CD28 antibody (PE) was raised in mouse using chicken CD28 as the immunogen.
Purity:Min. 95%Molecular weight:0 g/molMMP10 antibody
The MMP10 antibody is a polyclonal antibody that is used in immunohistochemical studies to detect the presence of matrix metalloproteinase 10 (MMP10) protein. This antibody is widely used in life sciences research to study various cellular processes, including pluripotent stem cell differentiation and hematopoietic development. The MMP10 antibody can be used as a valuable tool for researchers to investigate the expression and localization of MMP10 in different tissues and cell types. It can also be used to inhibit the activity of MMP10 or as a therapeutic reagent in the development of new cytokine inhibitors. With its high specificity and sensitivity, the MMP10 antibody is an essential component for any researcher working in the field of molecular biology and immunology.
Lactoferrin antibody
Lactoferrin antibody was raised in Mouse using Human lactoferrin as the immunogen.CD8a antibody
CD8a antibody was raised in Mouse using the alpha chainc of chicken CD8 as the immunogen.
UBE2M antibody
UBE2M antibody was raised using a synthetic peptide corresponding to a region with amino acids IKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISF
KLK6 antibody
The KLK6 antibody is an extracellular antibody that is primarily used in neuronal cultures for research purposes. This antibody specifically targets the phosphorylation site of KLK6, a protein that plays a crucial role in various biological processes within the Life Sciences field. KLK6 is known to interact with growth factors and synaptic proteins, and its activity has been linked to exocytosis and vesicular trafficking. By targeting KLK6, this polyclonal antibody can help researchers gain insights into the mechanisms of inhibitory neurotransmission and the regulation of protein isoforms. Additionally, it can be used to study the involvement of KLK6 in protein kinase signaling pathways.
QTRT1 antibody
QTRT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KDKPRYLMGVGYATDLVVCVALGCDMFDCVFPTRTARFGSALVPTGNLQL
CHKA antibody
CHKA antibody was raised using the middle region of CHKA corresponding to a region with amino acids LESVMFAILAERSLGPKLYGIFPQGRLEQFIPSRRLDTEELSLPDISAEI
NPDC1 antibody
NPDC1 antibody was raised using the N terminal of NPDC1 corresponding to a region with amino acids MATPLPPPSPRHLRLLRLLLSGLVLGAALRGAAAGHPDVAACPGSLDCAL
CD8B antibody
CD8B antibody was raised using the N terminal of CD8B corresponding to a region with amino acids RIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFI
Purity:Min. 95%SPP1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections as it exhibits bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth by preventing transcription and replication. Its potency has been demonstrated through a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.
Human Growth Hormone antibody (HRP)
Human growth hormone antibody (HRP) was raised in mouse using human growth hormone as the immunogen.
MOV10 antibody
MOV10 antibody was raised using a synthetic peptide corresponding to a region with amino acids AKLDLQQGQNLLQGLSKLSPSTSGPHSHDYLPQEREGEGGLSLQVEPEWR
EFNA4 antibody
The EFNA4 antibody is a monoclonal antibody that targets autoantibodies against the EFNA4 protein. This protein is involved in various biological processes, including cell adhesion and migration. The EFNA4 antibody can be used in research and diagnostic applications to detect the presence of autoantibodies in human serum.
RIPK4 antibody
RIPK4 antibody was raised using the N terminal of RIPK4 corresponding to a region with amino acids DGLFGTIAYLPPERIREKSRLFDTKHDVYSFAIVIWGVLTQKKPFADEKN
HSPA4 antibody
HSPA4 antibody was raised using the N terminal of HSPA4 corresponding to a region with amino acids PACISFGPKNRSIGAAAKSQVISNAKNTVQGFKRFHGRAFSDPFVEAEKS
GLUR1 antibody
The GLUR1 antibody is a reactive antibody that specifically targets the IL-1 receptor, an important component of the interleukin signaling pathway. This antibody is widely used in Life Sciences research to study the role of IL-1 in various biological processes. Additionally, it has been shown to inhibit the production of pancreatic glucagon, a hormone involved in regulating blood sugar levels.
PAD4 antibody
The PAD4 antibody is a highly specialized medicament used in the field of Life Sciences. It is an acidic, EGF-like glycoprotein that plays a crucial role in various biological processes. This antibody is particularly known for its ability to neutralize and inhibit the activity of glial fibrillary acidic protein (GFAP), which is found predominantly in adipocytes.
LCN2 antibody
The LCN2 antibody is a highly specialized antibody that targets sclerostin. It is available in both polyclonal and monoclonal forms, offering a wide range of options for researchers. The antibody has been shown to neutralize prorenin and inhibit glucose-6-phosphate activation, making it a valuable tool for studying these processes. Additionally, the LCN2 antibody can be used in various assays and experiments, thanks to its high specificity and affinity for the target antigen. Its activated colloidal gold conjugate allows for easy visualization and detection using techniques such as immunohistochemistry or Western blotting. Researchers can rely on the LCN2 antibody to provide accurate and reliable results in their studies.
C14ORF21 antibody
C14ORF21 antibody was raised using the middle region of C14Orf21 corresponding to a region with amino acids GGTILESERARPRGSQSSEAQKTPAQECKPADFEVPETFLNRLQDLSSSF
SIGLEC7 antibody
The SIGLEC7 antibody is an inhibitory antibody that targets adeno-associated viruses. It is a polyclonal antibody that specifically binds to the SIGLEC7 receptor, which is expressed on various immune cells. This antibody has been shown to inhibit the activity of serotonin, a neurotransmitter involved in regulating mood and behavior. In addition, it can also bind to antigenic proteins and block their interaction with other molecules. The SIGLEC7 antibody has potential applications in life sciences research and the development of therapeutic antibodies for various diseases. It can be used as a tool to study the function of SIGLEC7 and its role in immune responses. Furthermore, this antibody may have clinical implications as a potential treatment for autoimmune disorders or as a targeted therapy for certain types of cancer.
NOTCH1 antibody
The NOTCH1 antibody is a monoclonal antibody that specifically targets the NOTCH1 protein. It is commonly used in various assays and research studies in the field of life sciences. This antibody has been extensively tested and validated for its specificity and sensitivity.
CD25 antibody (PE-CY7)
CD25 antibody (PE) was raised in rat using IL-2-dependent BALB/c mouse helper T-cell clone HT-2 as the immunogen.
Purity:Min. 95%Molecular weight:0 g/molMVP antibody
MVP antibody was raised using the N terminal of MVP corresponding to a region with amino acids MATEEFIIRIPPYHYIHVLDQNSNVSRVEVGPKTYIRQDNERVLFAPMRM
HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productCA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
