Primary Antibodies

Rabbit polyclonal RPL13A antibody

PYGO1 antibody was raised in rabbit using the middle region of PYGO1 as the immunogen

The LHR antibody is a polyclonal antibody used in life sciences research. It specifically targets the luteinizing hormone receptor (LHR), which plays a crucial role in reproductive processes. This antibody is commonly used to study the interaction between LHR and various ligands, such as chemokines, on the microvascular endothelium. It can also be used in antigen-antibody reactions to detect the presence of LHR in different tissues or cell types. The LHR antibody is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific experimental needs. With its high specificity and sensitivity, this antibody is an invaluable tool for investigating the function and regulation of LHR in various biological contexts.

Rabbit polyclonal CK2A1 antibody (Tyr255)

PAIP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EPTFYTSDGVPFTAADPDYQEKYQELLEREDFFPDYEENGTDLSGAGDPY

The CPLA2 antibody is a monoclonal antibody that specifically targets cytosolic phospholipase A2 (cPLA2). cPLA2 is an enzyme that plays a crucial role in the release of arachidonic acid, which is a precursor for the synthesis of various bioactive lipid mediators. This antibody has been extensively used in research to study the role of cPLA2 in various cellular processes, including inflammation, cell growth, and neuroprotection. It has also been used to investigate the interactions between cPLA2 and other molecules such as growth factors and neurotrophic factors. The CPLA2 antibody is highly reactive and provides reliable results in experiments involving techniques like immunohistochemistry, Western blotting, and ELISA. Whether you are studying the effects of cPLA2 on glial fibrillary acidic protein or investigating its potential as a therapeutic target, this antibody will be an invaluable tool in your research.

CD45.2 antibody was raised in mouse using CD45.2 as the immunogen.

CMPK1 antibody was raised in Rabbit using Human CMPK1 as the immunogen

Affinity purified Rabbit polyclonal TFIID antibody

Human growth hormone antibody was raised in mouse using recombinant human growth hormone as the immunogen.

VCAM1 antibody was raised in Mouse using a purified recombinant fragment of human VCAM1 expressed in E. coli as the immunogen.

UTS2D antibody was raised in rabbit using the C terminal of UTS2D as the immunogen

The uPAR antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It specifically targets the urokinase plasminogen activator receptor (uPAR), which plays a crucial role in various biological processes such as cell adhesion, migration, and invasion. The uPAR antibody binds to the glycopeptide domain of uPAR, inhibiting its function and preventing the activation of downstream signaling pathways.

Rabbit polyclonal ACAC antibody (Ser80)

The Interferon alpha Receptor 1 antibody is a highly specialized polyclonal antibody that is used in immunoassays. This antibody specifically targets the Interferon alpha Receptor 1 protein, which plays a crucial role in the immune response. It can be used for various applications, including Western blotting, immunoprecipitation, and immunohistochemistry.

Factor IX antibody (biotin) was raised in goat using human Factor IX purified from plasma as the immunogen.

Rabbit polyclonal SDP3 antibody (FITC)

PTHLH antibody was raised using the middle region of PTHLH corresponding to a region with amino acids YKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLS

RPL7 antibody was raised in rabbit using the C terminal of RPL7 as the immunogen

Rabbit polyclonal Horse Serum Albumin antibody

The SP1 antibody is a glycoprotein inhibitor that is pegylated and classified as a monoclonal antibody. It is commonly used in Life Sciences research and has various applications. The SP1 antibody has been found to be effective in neutralizing the activity of trastuzumab, an antibody used in the treatment of breast cancer. Additionally, it has shown potential as a therapeutic agent for targeting specific growth factors, such as glucagon and fatty acid receptors. This antibody exhibits cytotoxic properties and can inhibit the growth of cancer cells by blocking essential cellular processes. Furthermore, the SP1 antibody has been utilized in studies involving glutamate receptors and has proven to be valuable in understanding their functions. Overall, this highly specialized antibody offers great potential for researchers seeking to investigate various biological pathways and targets within the human body.

The Listeria antibody is a polyclonal antibody that is used in Life Sciences research. It is commonly used in assays to detect the presence of Listeria monocytogenes, a bacterium that can cause serious infections in humans. This antibody specifically binds to nuclear antigens expressed by Listeria, allowing for easy detection and identification. The Listeria antibody is highly specific and sensitive, making it an essential tool for researchers studying this pathogen. It can be used in various applications, including immunohistochemistry, Western blotting, and ELISA assays. With its high affinity and specificity, the Listeria antibody provides accurate and reliable results in detecting Listeria monocytogenes in samples such as human serum or colloidal suspensions. Researchers rely on this powerful tool to advance their understanding of Listeria infection and develop effective treatments.

This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.

Mouse monoclonal GORASP1 antibody

FBXL14 antibody was raised in Rabbit using Human FBXL14 as the immunogen

ENPEP antibody is a monoclonal antibody that specifically targets ENPEP, an enzyme involved in the metabolism of progesterone and interferon. This antibody can be used for various applications in life sciences, including research on growth hormone receptor signaling, chemokine regulation, and steroid metabolism. It has also shown antiviral activity by inhibiting the replication of certain viruses in human serum. Additionally, this antibody has been used to detect ENPEP expression in tissues and cells using techniques such as immunohistochemistry and flow cytometry. Its high specificity and affinity make it a valuable tool for studying ENPEP-related processes and developing potential therapeutic strategies.

Insulin antibody is a specialized antibody that is used for the detection and measurement of insulin levels in various biological samples. It can be used in research, diagnostic, and clinical settings to study conditions such as hyperinsulinaemic hypoglycaemia or insulin resistance. This antibody is produced by antibody-secreting cells and can be obtained in both polyclonal and monoclonal forms. The polyclonal antibodies are derived from animals immunized with recombinant human insulin, while the monoclonal antibodies are generated through hybridoma technology. Insulin antibodies specifically bind to insulin molecules present in the sample, allowing for their detection and quantification. This enables researchers and healthcare professionals to accurately measure insulin levels in human serum or other biological fluids. The use of insulin antibodies offers a reliable and sensitive method for insulin detection. These antibodies have been extensively validated for their specificity and sensitivity, ensuring accurate results. They recognize specific epitopes on the insulin molecule, such as certain amino acid residues or the

Affinity purified Rabbit polyclonal PMM2 antibody

The TPM2 antibody is a highly specialized protein kinase that plays a crucial role in various biological processes. It belongs to the family of polyclonal antibodies and is widely used in life sciences research. This antibody specifically targets β-catenin, a key protein involved in cell adhesion and signaling pathways. By binding to β-catenin, the TPM2 antibody can modulate its activity and regulate downstream cellular processes.

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This compound works by binding to DNA-dependent RNA polymerase, inhibiting bacterial growth and preventing transcription and replication. Its potency has been demonstrated through patch-clamp techniques on human erythrocytes. Metabolically, it undergoes various transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.

The FANCA antibody is a monoclonal antibody that is used in Life Sciences research. It specifically targets and binds to the FANCA protein, which plays a crucial role in DNA repair and maintenance. By binding to FANCA, this antibody inhibits its proteolytic activity, preventing it from degrading important cellular components.

H2AFY2 antibody was raised using the middle region of H2AFY2 corresponding to a region with amino acids KKGGKKSKAAKPRTSKKSKPKDSDKEGTSNSTSEDGPGDGFTILSSKSLV

Rabbit polyclonal USP49 antibody

The Notch 1 antibody is a substance used in Life Sciences research and development. It is specifically designed to target and bind to the Notch 1 antigen, which plays a crucial role in cell signaling and development. By inhibiting the activity of Notch 1, this antibody can help researchers gain a better understanding of various biological processes.

The STK4 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets mycoplasma genitalium and has been shown to neutralize its effects. This antibody can be used in various applications, including the study of epidermal growth factor and collagen. Additionally, it has been found to have inhibitory properties against other growth factors such as TGF-beta. The STK4 antibody is also cytotoxic and can induce lysis in targeted cells. Researchers can use this antibody to investigate the role of specific proteins or pathways in cellular processes and disease development.

Affinity purified Rabbit polyclonal PRPF39 antibody

Affinity purified Rabbit polyclonal DCSIGN antibody

Affinity purified Rabbit polyclonal SERPINI2 antibody

NAB1 antibody was raised in mouse using recombinant Human Ngfi-A Binding Protein 1 (Egr1 Binding Protein 1)

Mouse monoclonal MRPS2 antibody

HMG20B antibody was raised in Rabbit using Human HMG20B as the immunogen

The IgG1 antibody is a highly versatile and potent medicament that belongs to the class of antibodies. It is activated upon binding to specific antigens, leading to cytotoxic effects on target cells. IgG1 antibodies play a crucial role in the immune response by neutralizing pathogens and promoting phagocytosis. These antibodies are widely used in life sciences research, diagnostics, and therapeutic applications.

The GPR171 antibody is a highly specialized monoclonal antibody that targets the GPR171 receptor. This receptor plays a crucial role in various biological processes, including erythropoietin signaling, TNF-α production, chemokine regulation, and microvessel density. The GPR171 antibody has been extensively studied and proven to be highly effective in neutralizing the activity of GPR171.

The Connexin 26 antibody is a highly effective biomolecule used in Life Sciences research. It is a polyclonal antibody that specifically targets and neutralizes the Connexin 26 protein, which plays a crucial role in cell communication. This antibody is widely used to study various cellular processes, including the regulation of glucagon secretion, autoantibody production, and the function of glycoproteins and steroids. Additionally, this monoclonal antibody has been proven to be effective in detecting and studying other biomolecules such as collagen, myelin-associated glycoprotein, interferon, and basic proteins. Researchers rely on the Connexin 26 antibody for its high specificity and reliability in their studies.

KRT14 antibody was raised in rabbit using the C terminal of KRT14 as the immunogen

The NMDAR1 antibody is a monoclonal antibody that targets the N-methyl-D-aspartate receptor subtype 1 (NMDAR1). This receptor is involved in various physiological processes, including synaptic plasticity and learning. The NMDAR1 antibody has been shown to inhibit the activation of NMDAR1 and reduce microvessel density in tumors by blocking the binding of growth factors to their receptors. It has also been demonstrated to modulate the expression of histidine, epidermal growth factor, and steroid receptors in granulosa cells. In addition, this antibody can activate e-cadherin and β-catenin signaling pathways, which are important for cell adhesion and migration. Overall, the NMDAR1 antibody offers promising applications in life sciences research and provides valuable insights into cellular mechanisms related to growth and development.

Rabbit polyclonal NOP2 antibody

Rabbit polyclonal CaMK2 alpha/beta/theta antibody

Affinity purified Rabbit polyclonal RAMP1 antibody

Rabbit polyclonal GPR152 antibody

KC antibody was raised in rabbit using highly pure recombinant murine KC as the immunogen.

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.