Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75562 products of "Primary Antibodies"
HEXA antibody
HEXA antibody is a highly specific and potent polyclonal antibody used in life sciences research. It is also available as a monoclonal antibody. This antibody specifically targets the natriuretic hormone peptide, TGF-beta, and has neutralizing properties. It can be used to study the role of these hormones in various biological processes. Additionally, HEXA antibody has cytotoxic effects on cells expressing certain growth factors, making it a valuable tool for studying cell signaling pathways. Moreover, this antibody can be used in studies related to lipid metabolism as it targets enzymes such as triglyceride lipase and lipoprotein lipase. Its wide range of applications makes HEXA antibody an essential component of any research project in the fields of life sciences and medicine.
GHRHR antibody
The GHRHR antibody is a powerful inhibitor that targets the TRPV4 channel, making it an effective medicament for various applications. This antibody specifically inhibits the activity of serine proteases, reducing the risk of excitotoxicity and protecting cells from damage. It has been widely used in the field of life sciences as a diagnostic agent to detect specific proteins such as myoglobin, fibrinogen, and MIP-1β. Additionally, this antibody has shown promising results in pluripotent stem cell research by regulating lactate production and promoting cell differentiation. With its multifaceted properties and diverse applications, the GHRHR antibody is a valuable tool for researchers and medical professionals alike.
NTR1 antibody
The NTR1 antibody is a polyclonal antibody that is commonly used in the field of Life Sciences. It is specifically designed to target and bind to NTR1, a protein that plays a crucial role in various biological processes. This antibody can be used for immobilization purposes, such as in immunoassays or for the detection of NTR1 in human serum samples.
ZFYVE27 antibody
ZFYVE27 antibody was raised using the C terminal of ZFYVE27 corresponding to a region with amino acids TFSVLKKRRSCSNCGNSFCSRCCSFKVPKSSMGATAPEAQRETVFVCASC
DNASE1L3 antibody
DNASE1L3 antibody was raised in rabbit using the C terminal of DNASE1L3 as the immunogen
C-myc antibody
The C-myc antibody is a monoclonal antibody that specifically targets the C-myc protein, a transcription factor involved in cell growth and proliferation. This antibody is widely used in life sciences research to study the expression and function of C-myc in various biological processes.
FTCD antibody
FTCD antibody was raised using the N terminal of FTCD corresponding to a region with amino acids FSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVE
GPT antibody
GPT antibody was raised using a synthetic peptide corresponding to a region with amino acids CGGHSLGAYSVSSGIQLIREDVARYIERRDGGIPADPNNVFLSTGASDAI
VAX2 antibody
VAX2 antibody was raised in mouse using recombinant Human Ventral Anterior Homeobox 2 (Vax2)
Amphetamine antibody
Amphetamine antibody was raised in mouse using amphetamine-BSA as the immunogen.CK1 delta antibody
CK1 delta antibody was raised using the middle region of CSNK1D corresponding to a region with amino acids NLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSR
HIV1 p24 antibody (HRP)
HIV1 p24 antibody (HRP) was raised in goat using purified native p24 from strain IIIB as the immunogen.MYPN antibody
The MYPN antibody is a retinoid that belongs to the class of antibodies. It specifically targets 6-phosphogluconate dehydrogenase and has antinociceptive properties. This monoclonal antibody is widely used in the field of Life Sciences and has been shown to inhibit methyl transferase activity. The MYPN antibody also plays a crucial role in collagen synthesis and can be used as an inhibitor for HDAC (histone deacetylase) enzymes. It is commonly used in the development of medicines and vaccines, particularly against nuclear-related diseases. Additionally, this polyclonal antibody has been shown to enhance acetylation processes and is effective against vaccine strains.
GSK3beta antibody
GSK3beta antibody was raised in mouse using recombinant human GSk3 beta (341-420aa) purified from E. coli as the immunogen.
MMP8 antibody
The MMP8 antibody is a polyclonal antibody that specifically targets matrix metalloproteinase 8 (MMP8). It is commonly used in research and diagnostic applications to detect and quantify the presence of MMP8 in various samples.
LTBR antibody
The LTBR antibody is a highly effective tool in the field of Life Sciences. It specifically targets and inhibits the activity of glycoproteins involved in various cellular processes. This polyclonal antibody has been extensively studied and shown to have potent cytotoxic effects on activated cells. Additionally, it has been found to interfere with the p38 mitogen-activated protein kinase (MAPK) pathway, a key signaling pathway involved in cell proliferation and survival.
HDAC2 antibody
The HDAC2 antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets and detects hepatocyte growth factor (HGF), fibronectin, collagen, and other important proteins. This antibody is widely used in research laboratories for various applications, including immunohistochemistry, western blotting, and enzyme-linked immunosorbent assays (ELISA). It can be used to study the expression and localization of HGF and other proteins in different tissues and cell types. The HDAC2 antibody is also commonly used in drug discovery and development to evaluate the effect of potential inhibitors on protein complexes involved in growth factor signaling pathways. Its high specificity and sensitivity make it an invaluable tool for researchers working in the fields of cell biology, molecular biology, and drug development.
Calretinin antibody
The Calretinin antibody is a highly reactive monoclonal antibody that targets the growth factor calretinin. Calretinin is a protein that contains numerous acid residues and is primarily found in mesothelial cells. This antibody has been extensively validated using techniques such as polymerase chain reaction (PCR) and immunohistochemistry to ensure its specificity and reliability.
BOP1 antibody
BOP1 antibody was raised using the N terminal of BOP1 corresponding to a region with amino acids MAGSRGAGRTAAPSVRPEKRRSEPELEPEPEPEPPLLCTSPLSHSTGSDS
CD33 antibody
CD33 antibody was raised in Mouse using a purified recombinant fragment of CD33(48-258) expressed in E. coli as the immunogen.V5 Tag antibody
The V5 Tag antibody is a monoclonal antibody used in Life Sciences research. It specifically binds to the V5 epitope, a small peptide sequence that is commonly fused to target proteins for detection and purification purposes. This antibody is widely used in various applications, including Western blotting, immunoprecipitation, and immunofluorescence.
HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productCA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
