Primary Antibodies

Rabbit polyclonal Tumor necrosis factor antibody (biotin)

<p>ZBP1 antibody was raised using the middle region of ZBP1 corresponding to a region with amino acids LYRMKSRHLLDMDEQSKAWTIYRPEDSGRRAKSASIIYQHNPINMICQNG</p>

<p>Rabbit polyclonal TAF13 antibody</p>

<p>SREBF2 antibody was raised in rabbit using the middle region of SREBF2 as the immunogen</p>

<p>Rabbit polyclonal Annexin A2 antibody (biotin)</p>

<p>The Vitronectin antibody is a monoclonal antibody that specifically targets the erythropoietin receptor. This antibody has been extensively studied and proven to be highly effective in various applications. It can be used for research purposes, diagnostic assays, and therapeutic interventions.</p>

FUT6 antibody was raised in Rabbit using Human FUT6 as the immunogen

<p>The Lamin A Antibody is a highly effective cytotoxic agent used in Life Sciences research. This antibody specifically targets human hepatocytes and immobilizes them, allowing for accurate and reliable assays. It is a monoclonal antibody that binds to the antigen transthyretin, inhibiting its activity and preventing interference with experimental results. The Lamin A Antibody has been extensively tested and shown to be activated by interferon, making it an ideal tool for studying immune responses. With its high specificity and affinity for its target, this monoclonal antibody is a valuable asset in any laboratory setting.</p>

Rabbit polyclonal GPR126 antibody

<p>Desmoglein 1/2 antibody was raised in mouse using “Band 3” polypeptide of isolated desmosomes from bovine muzzle epidermis as the immunogen.</p>

<p>Ctp Synthase antibody was raised using the C terminal of CTPS corresponding to a region with amino acids FGLLLASVGRLSHYLQKGCRLSPRDTYSDRSGSSSPDSEITELKFPSINH</p>

<p>Rabbit polyclonal RPS14 antibody (FITC)</p>

<p>EVL antibody was raised in Rabbit using Human EVL as the immunogen</p>

<p>SYNCRIP antibody was raised using the N terminal of SYNCRIP corresponding to a region with amino acids MATEHVNGNGTEEPMDTTSAVIHSENFQTLLDAGLPQKVAEKLDEIYVAG</p>

<p>Purified Polyclonal PPHLN1 antibody</p>

<p>CD97 antibody was raised in Rabbit using Human CD97 as the immunogen</p>

<p>DAK antibody was raised in Rabbit using Human DAK as the immunogen</p>

<p>TFF1 antibody is a monoclonal antibody that specifically targets alpha-fetoprotein. It is commonly used in life sciences research to study the role of TFF1 in various biological processes. The antibody can be used in different applications, such as immunohistochemistry and Western blotting, to detect and quantify TFF1 levels. Additionally, TFF1 antibody can be utilized in experiments involving hydrogen fluoride polymers, antibodies immobilized on electrodes, or monolayer cultures. This versatile tool allows researchers to investigate the function of TFF1 and its interactions with other molecules, such as protein kinases or glucagon inhibitors. With its high specificity and sensitivity, the TFF1 antibody is an essential component for any study involving TFF1-related mechanisms.</p>

<p>DKK3 antibody was raised in Mouse using a purified recombinant fragment of human DKK3 expressed in E. coli as the immunogen.</p>

<p>MGC3207 antibody was raised in rabbit using the N terminal of MGC3207 as the immunogen</p>

<p>The RANK antibody is a polyclonal antibody that is used in Life Sciences research. It specifically targets the receptor activator of nuclear factor kappa-B (RANK), which plays a crucial role in various biological processes such as bone remodeling, immune system regulation, and mammary gland development. The RANK antibody is highly specific and has been validated for use in multiple applications including Western blotting, immunohistochemistry, and flow cytometry.</p>

<p>The Lysozyme antibody is a powerful tool in the field of Life Sciences. It is an antibody that specifically targets and detects lysozyme, an enzyme found in various biological systems. This antibody can be used in a wide range of applications, including androgen assays, immunohistochemistry, Western blotting, and ELISA.</p>

<p>Integrin beta antibody is a powerful tool used in Life Sciences research. It is a monoclonal antibody that specifically binds to integrin beta, a receptor involved in cell adhesion and signaling. This antibody can be used to study various cellular processes, including cell migration, proliferation, and differentiation. Integrin beta antibody has been widely used in studies related to cancer research, autoimmune diseases, and inflammation. Its high specificity and affinity make it an ideal choice for researchers looking to investigate the role of integrin beta in different biological systems. Whether you are studying growth factors, chemokines, or collagen interactions, this antibody will provide valuable insights into cellular mechanisms. With its precise targeting ability and disulfide bond formation inhibition properties, Integrin beta antibody is a crucial component in understanding complex molecular pathways. Trust this reliable tool for your research needs and unlock new discoveries in the field of Life Sciences.</p>

<p>TNFSF10 antibody was raised in rabbit using the N terminal of TNFSF10 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal CBFA1 antibody</p>

<p>The BRCA2 antibody is a highly specific monoclonal antibody that is used in Life Sciences research. It specifically targets the BRCA2 protein, which is involved in DNA repair and maintenance of genomic stability. This antibody can be used for various applications, including Western blotting, immunohistochemistry, and flow cytometry. It has been shown to have high affinity and specificity for the BRCA2 protein, making it a valuable tool for studying its function and regulation. Additionally, this antibody does not cross-react with other proteins such as transferrin, alpha-fetoprotein, collagen, or lipoprotein lipase, ensuring accurate and reliable results. Whether you are studying DNA repair mechanisms or investigating the role of BRCA2 in cancer development, this BRCA2 antibody will provide you with the precise and reliable data you need for your research.</p>

<p>CDS2 antibody was raised in Rabbit using Human CDS2 as the immunogen</p>

<p>Rabbit polyclonal CKS1 antibody</p>

Mammaglobin 1 antibody was raised in Mouse using a purified recombinant fragment of SCGB2A2(aa1-193) expressed in E. coli as the immunogen.

Purified Rabbit polyclonal UBF antibody (Ser484)

Rabbit polyclonal PPP1R7 antibody

<p>The CDC2 antibody is a highly specialized antibody used in Life Sciences research. It is specifically designed to target and bind to the CDC2 protein, which plays a crucial role in cell division and regulation. This antibody is widely used in studies involving mesenchymal stem cells and their activation, as well as in the detection of autoantibodies and amyloid plaque formation.</p>

<p>Rabbit polyclonal IKK gamma antibody</p>

<p>CTDSP1 antibody was raised in Rabbit using Human CTDSP1 as the immunogen</p>

<p>Rabbit polyclonal ALPK2 antibody</p>

<p>Affinity purified Rabbit polyclonal Cofilin 2 antibody</p>

<p>VPS26A antibody was raised in rabbit using the C terminal of VPS26A as the immunogen</p>

<p>The PGM2 antibody is a highly specialized antibody used in Life Sciences for various applications. It is a polyclonal antibody that specifically targets PGM2, a glycoprotein involved in transfer reactions. This antibody is commonly used in immunoassays and other research techniques to detect and quantify PGM2 levels in biological samples.</p>

<p>CD166 antibody was raised in Mouse using a purified recombinant fragment of CD166(aa405-524) expressed in E. coli as the immunogen.</p>

<p>RIPK1 antibody was raised in rabbit using the middle region of RIPK1 as the immunogen</p>

<p>KCTD13 antibody was raised using the N terminal of KCTD13 corresponding to a region with amino acids PGPAAYGLKPLTPNSKYVKLNVGGSLHYTTLRTLTGQDTMLKAMFSGRVE</p>

IPP antibody was raised using the C terminal of IPP corresponding to a region with amino acids EMQGLIYVIGGISNEGIELRSFEVYDPLSKRWSPLPPMGTRRAYLGVAAL

DNAJA1 antibody was raised in Rabbit using Human DNAJA1 as the immunogen

CLIC4 antibody was raised in Rabbit using Human CLIC4 as the immunogen

<p>Troponin T Type 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PRPKLTAPKIPEGEKVDFDDIQKKRQNKDLMELQALIDSHFEARKKEEEE</p>

<p>WDR49 antibody was raised using the N terminal of WDR49 corresponding to a region with amino acids SQDFRCLFHFDEAHGRLFISFNNQLALLAMKSEASKRVKSHEKAVTCVLY</p>

<p>FAK antibody was raised in Mouse using a purified recombinant fragment of human FAK expressed in E. coli as the immunogen.</p>

<p>The SGSH antibody is a highly specialized antibody that targets sulfatase, an enzyme involved in the breakdown of complex molecules called glycosaminoglycans (GAGs). This antibody specifically recognizes and binds to the sulfatase nucleotide-binding site, inhibiting its activity.</p>

<p>Affinity purified Rabbit polyclonal DNA ligase 3 antibody</p>

The AP2M1 antibody is a highly specialized antibody used in Life Sciences research. It is primarily used to detect androgen receptors in blood plasma, making it an invaluable tool for studying hormone-related processes. This cytotoxic antibody specifically targets actin filaments within cells, allowing researchers to visualize and study the dynamics of actin in various cellular processes. Additionally, the AP2M1 antibody can be used to investigate the role of nuclear antigens and extracellular proteins involved in cell signaling pathways. Its high specificity and sensitivity make it a valuable tool for researchers studying microvessel density and other related areas of research. Whether you need a monoclonal or polyclonal antibody, the AP2M1 antibody is an excellent choice for your research needs.

Rabbit polyclonal NTHL1 antibody

<p>DDT antibody is an activated phosphatase that belongs to the class of monoclonal antibodies. It is used in life sciences research for various applications, including immunohistochemistry, Western blotting, and ELISA. DDT antibody specifically binds to DDT (dichlorodiphenyltrichloroethane), a synthetic insecticide that was widely used in the past but has since been banned due to its harmful effects on the environment and human health. This antibody can be used to detect and neutralize DDT in samples such as human serum or environmental samples. It has high affinity and specificity for DDT and does not cross-react with other compounds. The DDT antibody is conjugated with a fluorescent or enzymatic tag, allowing for easy detection and quantification of DDT in various assays.</p>

<p>Collagen type IV antibody (biotin) was raised in rabbit using collagen type IV from human and bovine placenta as the immunogen.</p>

<p>TRH antibody was raised in rabbit using the C terminal of TRH as the immunogen</p>

<p>CHMP1B antibody was raised in Rabbit using Human CHMP1B as the immunogen</p>

<p>Rabbit Polyclonal MRLC2 antibody (Ser18)</p>

<p>The LHR antibody is a polyclonal antibody used in life sciences research. It specifically targets the luteinizing hormone receptor (LHR), which plays a crucial role in reproductive processes. This antibody is commonly used to study the interaction between LHR and various ligands, such as chemokines, on the microvascular endothelium. It can also be used in antigen-antibody reactions to detect the presence of LHR in different tissues or cell types. The LHR antibody is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific experimental needs. With its high specificity and sensitivity, this antibody is an invaluable tool for investigating the function and regulation of LHR in various biological contexts.</p>

<p>Akt, or Protein Kinase B (PKB), is a kinase crucial for cell growth, survival, metabolism, and proliferation within the PI3K/Akt/mTOR pathway, which responds to external signals like growth factors. Activated through phosphorylation at specific sites, Akt influences key cellular processes by promoting cell survival, aiding protein synthesis through mTOR activation, regulating glucose metabolism, and supporting blood vessel formation and cell movement. Its hyperactivation is common in cancers, making it a target for cancer therapies, while its role in glucose regulation links it to insulin resistance and type 2 diabetes.</p>

Rabbit polyclonal IL1A antibody (biotin)

<p>PAIP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EPTFYTSDGVPFTAADPDYQEKYQELLEREDFFPDYEENGTDLSGAGDPY</p>

<p>Rabbit polyclonal ZNF18 antibody</p>

<p>CD45.2 antibody was raised in mouse using CD45.2 as the immunogen.</p>

<p>CACNB2 antibody was raised using the middle region of CACNB2 corresponding to a region with amino acids HLADYLEAYWKATHPPSSSLPNPLLSRTLATSSLPLSPTLASNSQGSQGD</p>

<p>AKR7A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids VETELFPCLRHFGLRFYAFNPLAGGLLTGKYKYEDKNGKQPVGRFFGNTW</p>

<p>The AATF antibody is a glycosylated antibody that plays a crucial role in endothelial growth and development. It is commonly used in Life Sciences research to study the effects of various factors on cell growth and apoptosis. This antibody has been shown to interact with erythropoietin, human serum albumin, and other proteins involved in cell signaling pathways. Additionally, it has been found to bind to nuclear proteins and amyloid plaque, suggesting its potential involvement in neurodegenerative diseases. The AATF antibody is also used in studies related to androgen signaling and can be a valuable tool for researchers studying these areas of interest. With its high specificity and affinity for its target molecules, this polyclonal antibody offers reliable results for various applications.</p>

<p>UTS2D antibody was raised in rabbit using the C terminal of UTS2D as the immunogen</p>

<p>Rabbit polyclonal PPIB antibody</p>

<p>Rabbit polyclonal MEF2A antibody (Thr312)</p>

<p>The Interferon alpha Receptor 1 antibody is a highly specialized polyclonal antibody that is used in immunoassays. This antibody specifically targets the Interferon alpha Receptor 1 protein, which plays a crucial role in the immune response. It can be used for various applications, including Western blotting, immunoprecipitation, and immunohistochemistry.</p>

<p>Factor IX antibody (biotin) was raised in goat using human Factor IX purified from plasma as the immunogen.</p>

Rabbit polyclonal C21orf33 antibody (FITC)

<p>The MKK6 antibody is a monoclonal antibody that is used in Life Sciences research. It specifically targets and binds to MKK6, a protein involved in various cellular processes such as endothelial growth and the production of growth factors. This antibody has been shown to inhibit the activity of MKK6, making it a valuable tool for studying its function and potential therapeutic applications.</p>

<p>PTHLH antibody was raised using the middle region of PTHLH corresponding to a region with amino acids YKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLS</p>

Rabbit polyclonal CD249 antibody

<p>RPL7 antibody was raised in rabbit using the C terminal of RPL7 as the immunogen</p>

<p>Mouse monoclonal Cytokeratin antibody cocktail (Prediluted for IHC)</p>

<p>CCND1 antibody was raised in rabbit using the middle region of CCND1 as the immunogen</p>

PGM1 antibody was raised using the middle region of PGM1 corresponding to a region with amino acids ATIRLYIDSYEKDVAKINQDPQVMLAPLISIALKVSQLQERTGRTAPTVI

<p>Rabbit polyclonal ABL1 antibody (HRP)</p>

<p>Rabbit Polyclonal SHP1 antibody (Tyr536)</p>

<p>Purified Rabbit polyclonal PRpha antibody</p>

<p>Rabbit polyclonal YedQ antibody (FITC)</p>

<p>ATXN7L2 antibody was raised using the middle region of ATXN7L2 corresponding to a region with amino acids NTPSPSFSKLPPSKASKSSKGKDGVEVEAPSRKRKLSPGPTTLKRTCILE</p>

<p>Affinity purified Rabbit polyclonal IP6K1 antibody</p>

<p>CACNB2 antibody was raised using the middle region of CACNB2 corresponding to a region with amino acids AYWKATHPPSSSLPNPLLSRTLATSSLPLSPTLASNSQGSQGDQRTDRSA</p>

ApoA antibody was raised in Mouse using a purified recombinant fragment of ApoA(4330-4521) expressed in E. coli as the immunogen.

<p>Rabbit polyclonal CYSLTR1 antibody</p>

<p>CCNE2 antibody was raised in rabbit using the N terminal of CCNE2 as the immunogen</p>

<p>The HDAC7 antibody is a powerful tool used in the field of Life Sciences. It is an antibody that specifically targets and binds to HDAC7, an enzyme involved in endothelial growth. This monoclonal antibody is produced by hybridoma cells and has been extensively tested for its specificity and reliability.</p>

<p>Tetraspanin 32 antibody was raised using the middle region of TSPAN32 corresponding to a region with amino acids EDCLQGIRSFLRTHQQVASSLTSIGLALTVSALLFSSFLWFAIRCGCSLD</p>

The CKMM antibody is a specific monoclonal antibody that targets creatine kinase MM (CKMM). This antibody has been extensively studied in the field of Life Sciences and has shown great potential in various applications. CKMM is an enzyme involved in energy metabolism, specifically in the conversion of creatine to phosphocreatine, which plays a crucial role in muscle contraction.

<p>ACADVL antibody was raised in Rabbit using Human ACADVL as the immunogen</p>

<p>CFB antibody was raised in Rabbit using Human CFB as the immunogen</p>

<p>ATP8B2 antibody was raised using the N terminal of ATP8B2 corresponding to a region with amino acids KTSKYNILTFLPVNLFEQFQEVANTYFLFLLILQLIPQISSLSWFTTIVP</p>

<p>The SHBG Antibody is a highly effective monoclonal antibody used in Life Sciences research. It specifically targets and binds to sex hormone-binding globulin (SHBG), a protein that plays a crucial role in regulating the bioavailability of insulin and other hormones. By binding to SHBG, this antibody disrupts its function, leading to cytotoxic effects on cells.</p>

Rabbit polyclonal virD2 antibody (FITC)

Rabbit polyclonal PTPRE antibody

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known to effectively treat tuberculosis infections by targeting the active compounds and exhibiting bactericidal activity. Through its binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. This drug has been extensively studied using advanced techniques such as the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.

<p>Rabbit polyclonal DGKQ antibody</p>

NCSTN antibody was raised in Rabbit using Human NCSTN as the immunogen