Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75562 products of "Primary Antibodies"
Chlamydia trachomatis antibody
Chlamydia trachomatis antibody was raised in mouse using Chlamydia trachomatis LPS as the immunogen.TACC3 antibody
The TACC3 antibody is a highly specialized monoclonal antibody that has receptor binding capabilities. It acts as a phosphatase, neutralizing specific targets in the body. This antibody is widely used in Life Sciences research and has shown promising results in various studies. It has been found to have an inhibitory effect on alpha-fetoprotein, a protein found in human serum that is associated with certain diseases. The TACC3 antibody can also block the activity of angptl3, a chemokine involved in inflammatory processes. With its immunosuppressant properties, this monoclonal antibody holds great potential for therapeutic applications and further exploration in the field of medicine.
FBXO24 antibody
FBXO24 antibody was raised using the middle region of FBXO24 corresponding to a region with amino acids QTLQDRTEKMKEIVGWMPLMAAQKDFFWEALDMLQRAEGGGGGVGPPAPE
CD22 antibody
The CD22 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target the CD22 protein, which plays a crucial role in immune response regulation. This antibody can be used for various applications, including the study of tyrosine signaling pathways, the development of recombinant proteins, and the identification of growth factor inhibitors.
EDAR antibody
EDAR antibody is a cytotoxic monoclonal antibody that targets the EDAR protein. It contains disulfide bonds and has been shown to inhibit the binding of c-myc to its target DNA sequence. This antibody can be used for hybridization studies, as well as in vitro and in vivo experiments to investigate the role of EDAR in various biological processes. The EDAR antibody has been used as an inhibitor in studies investigating the function of EDAR signaling pathways. It has also been used in combination with other antibodies or drugs, such as ketamine, to enhance its cytotoxic effects. This monoclonal antibody specifically binds to the extracellular domain of EDAR and has been used as a tool in life sciences research to study the function and regulation of this protein.TBRG4 antibody
The TBRG4 antibody is a highly specialized antibody complex used in the field of Life Sciences. It plays a crucial role in detecting and targeting amyloid plaque, which is associated with various neurodegenerative diseases. This antibody has the ability to bind to specific growth factors and proteins present in amyloid plaques, allowing for precise and targeted treatment options.
CROT antibody
The CROT antibody is a highly specialized monoclonal antibody that targets autoantibodies and has antiviral properties. It is commonly used in high-flux assays and life science research to detect and measure the levels of interleukins, carnitine, and octanoyltransferase. This antibody is designed to specifically bind to CROT protein, inhibiting its activity and preventing the formation of antibodies that can cause autoimmune diseases. With its ability to accurately detect extracellular antibodies, the CROT antibody plays a crucial role in the development of new medicines and therapies targeting autoimmune disorders.
CD38 antibody (Spectral Red)
CD38 antibody (Spectral Red) was raised in rat using CD38 as the immunogen.
Purity:Min. 95%Molecular weight:0 g/molInsulin antibody
Insulin antibody is a highly specialized product used in Life Sciences research. It is an activated polyclonal antibody that specifically targets insulin. This antibody is widely used in immunohistochemistry studies to detect and visualize insulin expression in tissues. It has also been shown to have neutralizing activity against insulin, making it a valuable tool for studying the role of insulin in various biological processes.
ENO2 antibody
The ENO2 antibody is a highly specialized product that plays a crucial role in various areas of life sciences. This polyclonal antibody is specifically designed to target and detect autoantibodies associated with microvessel density. It utilizes particle chemiluminescence technology, allowing for accurate and efficient detection.
Guinea Pig RBC antibody (Texas Red)
Guinea pig RBC antibody (Texas Red) was raised in rabbit using guinea pig erythrocytes as the immunogen.SPARC antibody
The SPARC antibody is a highly reactive and neutralizing monoclonal antibody used in Life Sciences research. It is designed to specifically target and bind to the SPARC protein, which plays a crucial role in various cellular processes such as cell adhesion, migration, and proliferation. This antibody can be used for intraocular applications, as well as in vitro experiments involving chemokine signaling pathways, fatty acid metabolism, fibroin synthesis, and telomerase activity. Additionally, the SPARC antibody has been shown to have potential therapeutic applications in regenerative medicine due to its ability to interact with mesenchymal stem cells and modulate their behavior. Whether you need a recombinant antigen or polyclonal antibodies for your research, the SPARC antibody is an essential tool that can provide valuable insights into cellular mechanisms and contribute to advancements in the field of Life Sciences.
Influenza A antibody
Influenza A antibody was raised in mouse using influenza virus type A haemagglutinin H1 as the immunogen.
RG9MTD2 antibody
RG9MTD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EDLIYLTSDSPNILKELDESKAYVIGGLVDHNHHKGLTYKQASDYGINHA
K2 antibody
The K2 antibody is a highly effective nucleotide molecule that targets alpha-synuclein, a protein associated with neurodegenerative diseases such as Parkinson's and Alzheimer's. This anti-her2 antibody-drug conjugate specifically binds to the HER2 receptor, which is overexpressed in certain types of cancer cells. It works by inhibiting the epidermal growth factor signaling pathway, preventing the growth and proliferation of cancer cells.
GLUT4 antibody
The GLUT4 antibody is a glycoprotein that plays a crucial role in glucose metabolism. It is activated by androgen and protein kinase, leading to the translocation of GLUT4 from intracellular vesicles to the plasma membrane. This enables the uptake of glucose into cells, regulating blood sugar levels. The GLUT4 antibody can be used for various applications, including research in human serum, detection of autoantibodies, growth factor studies, anti-angiogenesis research, and as an essential tool for the development of antibodies in Life Sciences. With both polyclonal and monoclonal antibodies available, this product provides researchers with reliable options for their experiments. Additionally, it can be used as an inhibitor to study the function and regulation of GLUT4 in different cellular processes.
Purity:Min. 95%Antithrombin III antibody
Antithrombin III antibody was raised in goat using human antithrombin purified from plasma as the immunogen.Purity:Min. 95%TMEM195 antibody
TMEM195 antibody was raised using the N terminal of TMEM195 corresponding to a region with amino acids MKNPEAQQDVSVSQGFRMLFYTMKPSETSFQTLEEVPDYVKKATPFFISL
Purity:Min. 95%CD62E antibody
The CD62E antibody is a monoclonal antibody that has antiviral properties and is commonly used in research and medical applications. It specifically targets the CD62E protein, also known as E-selectin, which plays a crucial role in immune response and inflammation. This antibody works by binding to the CD62E protein, preventing its interaction with other molecules involved in immune cell adhesion and migration.FKBP52 antibody
The FKBP52 antibody is a highly specific monoclonal antibody used in the field of Life Sciences. It is designed to target and bind to FKBP52, an important protein involved in various cellular processes. This antibody has been extensively studied and proven to be effective in detecting autoantibodies, histidine residues, alkaline phosphatases, epidermal growth factor (EGF), transforming growth factor-beta1 (TGF-beta1), and other growth factors.
CD19 antibody (PE-CY7)
CD19 antibody (PE-CY5.5) was raised in mouse using human CD19 as the immunogen.
Purity:Min. 95%Molecular weight:0 g/molSTEAP3 antibody
STEAP3 antibody was raised using the C terminal of STEAP3 corresponding to a region with amino acids VALVLSTLHTLTYGWTRAFEESRYKFYLPPTFTLTLLVPCVVILAKALFL
Purity:Min. 95%Synaptotagmin antibody
The Synaptotagmin antibody is a highly specialized polyclonal antibody that is used in various assays and experiments in the field of Life Sciences. This antibody has the unique ability to neutralize the activity of glucose-6-phosphate, making it an essential tool for studying the role of this molecule in cellular processes. The Synaptotagmin antibody is available in both monoclonal and polyclonal forms, providing researchers with options to suit their specific needs. With its high affinity and specificity, this antibody can be used for a wide range of applications, including immunohistochemistry, Western blotting, and flow cytometry. Whether you are studying protein-protein interactions or investigating disease mechanisms, the Synaptotagmin antibody is an indispensable tool for your research. Trust in its reliability and accuracy to deliver accurate and reproducible results every time.
IFN gamma antibody
IFN gamma antibody is a highly specific antibody that targets interferon gamma, a key cytokine involved in immune response regulation. This antibody can be used in various research applications, including immunohistochemistry, Western blotting, and ELISA. It specifically recognizes the carbonyl group of IFN gamma and has been extensively validated for its high affinity and specificity. It can effectively neutralize the activity of IFN gamma in vitro and in vivo, making it a valuable tool for studying the role of this cytokine in various biological processes. Whether you are investigating immune responses, studying growth factors, or exploring the effects of IFN gamma on different cell types, this antibody is an excellent choice for your research needs. Trust its reliable performance to provide accurate and reproducible results every time.
N Cadherin antibody
The N Cadherin antibody is a trifunctional antibody that has various applications in the field of Life Sciences. It can be used for research purposes, such as studying growth factors and their interactions with human serum. This antibody is commonly used in laboratory settings and can be used in experiments involving electrodes and other scientific equipment.
Goat anti Human Lambda Chain (biotin)
Goat anti-human lambda chain (biotin) was raised in goat using human l lambda chain as the immunogen.
Purity:Min. 95%GATA1 antibody
The GATA1 antibody is a powerful tool in the field of life sciences. It is a polyclonal antibody that specifically targets GATA1, a transcription factor involved in the regulation of gene expression. This antibody can be used to study various cellular processes, including cell differentiation, proliferation, and apoptosis. The GATA1 antibody has been shown to have cytotoxic effects on certain cancer cells and can also modulate the production of interferon-gamma (IFN-gamma), an important cytokine involved in immune responses. Additionally, this antibody has been used in research related to β-catenin signaling pathway and growth factors. Whether you are studying antiviral mechanisms or nuclear signaling events, the GATA1 antibody is an essential tool for your research needs.
Purity:Min. 95%IBSP antibody
IBSP antibody was raised using a synthetic peptide corresponding to a region with amino acids SATTLGYGEDATPGTGYTGLAAIQLPKKAGDITNKATKEKESDEEEEEEE
Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productHBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
