Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75562 products of "Primary Antibodies"
SCF antibody
The SCF antibody is a polyclonal antibody that has the ability to neutralize the activity of stem cell factor (SCF). Stem cell factor is an important growth factor involved in various cellular processes, including cell proliferation, differentiation, and survival. The SCF antibody can specifically bind to SCF and inhibit its function, preventing it from interacting with its receptor and initiating downstream signaling pathways.
Chicken anti Goat IgG (H + L) (Alk Phos)
This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.Purity:Min. 95%MEF2A antibody
The MEF2A antibody is a powerful tool used in life sciences research. It is a monoclonal antibody that specifically targets the MEF2A protein, which plays a crucial role in various cellular processes including growth factor signaling and interferon production. This antibody can be used for a wide range of applications, such as western blotting, immunofluorescence, and immunohistochemistry.
Purity:Min. 95%Rat Thrombocyte antibody
Rat thrombocyte antibody was raised in rabbit using rat thrombocytes as the immunogen.
Purity:Min. 95%Goat anti Human IgG (HRP)
Goat anti-human IgG (HRP) was raised in goat using human IgG gamma chain as the immunogen.Purity:Min. 95%CDH13 antibody
The CDH13 antibody is a glycoprotein that specifically targets autoantibodies. It is a monoclonal antibody that contains a cycloalkyl group and has been shown to have cytotoxic effects. This antibody can be used in various applications, including immunohistochemistry, flow cytometry, and Western blotting. The CDH13 antibody has been used in research studies to investigate the role of CDH13 in different biological processes, such as cell adhesion and migration. It has also been used in combination with other antibodies, such as anti-CD33 antibody or sorafenib, to enhance its therapeutic potential. The CDH13 antibody has shown promising results in preclinical studies, demonstrating its ability to induce hemolysis and necrosis factor-related apoptosis-inducing effects on target cells. With its wide range of applications and potential therapeutic benefits, the CDH13 antibody is an essential tool for researchers in the field of Life Sciences.
Septin 10 antibody
Septin 10 antibody was raised using the C terminal of 40431 corresponding to a region with amino acids ERMKLEEKRRLLEEEIIAFSKKKATSEIFHSQSFLATGSNLRKDKDRKNS
ZNF12 antibody
ZNF12 antibody was raised in rabbit using the N terminal of ZNF12 as the immunogen
Purity:Min. 95%Donkey anti Mouse IgG (H + L) (FITC)
This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.
Purity:Min. 95%IQCE antibody
IQCE antibody was raised using the middle region of IQCE corresponding to a region with amino acids KKMGSALLSLSRSVQELTEENQSLKEDLDRVLSTSPTISKTQGYVEWSKP
Goat anti Human IgG (HRP)
This antibody reacts with heavy chains on human IgG (gamma chain).Purity:Min. 95%MDMA antibody
The MDMA antibody is a monoclonal antibody that is used in Life Sciences research. It has the ability to specifically bind to MDMA (3,4-methylenedioxymethamphetamine), commonly known as ecstasy. This antibody can be used for various applications, such as detecting MDMA in biological samples or studying its effects on different systems.
Purity:Min. 95%Mouse anti Goat IgG (H + L) (HRP)
Mouse anti-goat IgG (H + L) (HRP) was raised in mouse using goat IgG (H & L) as the immunogen.Purity:Min. 95%Goat anti Rabbit IgG (H + L) (FITC)
This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.Rabbit anti Goat IgG (Texas Red)
Rabbit anti-goat IgG was raised in rabbit using goat IgG F(c) fragment as the immunogen.Purity:Min. 95%Goat anti Monkey IgG (HRP)
Goat anti-monkey IgG (HRP) was raised in goat using monkey IgG chain as the immunogen.GAPDH antibody
The GAPDH antibody is a highly specialized and pegylated antibody that targets the glycoprotein known as glyceraldehyde-3-phosphate dehydrogenase (GAPDH). This antibody plays a crucial role in various biological processes, including epidermal growth factor (EGF) signaling, microvessel density regulation, and growth factor activity.Purity:Min. 95%Goat anti Rabbit IgG (H + L) (Alk Phos)
This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.Purity:Min. 95%HTR1A antibody
HTR1A antibody was raised in rabbit using the N terminal of HTR1A as the immunogen
Purity:Min. 95%Rabbit anti Rat IgG (H + L)
Rabbit anti-rat IgG (H+L) was raised in rabbit using rat IgG whole molecule as the immunogen.Purity:Min. 95%PAOX antibody
PAOX antibody was raised using a synthetic peptide corresponding to a region with amino acids GGRIRSERCFGGVVEVGAHWIHGPSRGNPVFQLAAEYGLLGEKELSQENQ
Mouse anti Human IgM
Mouse anti Human IgM is a monoclonal antibody that specifically targets human IgM antibodies. It is widely used in the field of life sciences for various applications, including immunohistochemistry, flow cytometry, and ELISA assays. This antibody has high affinity and specificity towards human IgM, making it an essential tool for researchers studying immune responses and antibody-mediated diseases.
Purity:Min. 95%Goat anti Mouse IgG + IgM (H + L) (Alk Phos)
Goat anti-mouse IgG/IgM (H+L) (Alk Phos) was raised in goat using murine IgG and IgM whole molecules as the immunogen.
Purity:Min. 95%Goat anti Human IgE (epsilon chain) (biotin)
This antibody reacts with heavy chains on human IgE (epsilon chain).Purity:Min. 95%Cofilin antibody
The Cofilin antibody is a highly effective inhibitor that belongs to the class of monoclonal antibodies. It works by targeting and neutralizing chemokines, interferons, and growth factors that are activated and reactive in the body. This antibody has been shown to inhibit the activity of 3-kinase enzymes, which play a crucial role in cell growth and proliferation. Additionally, it can also bind to autoantibodies and taxol, preventing their harmful effects on the body. The Cofilin antibody has been extensively studied for its potential therapeutic applications in various diseases and conditions.
Purity:Min. 95%Gja4 antibody
Gja4 antibody was raised in rabbit using the N terminal of GJA4 as the immunogenPurity:Min. 95%Goat anti Guinea Pig IgG (H + L) (rhodamine)
This antibody reacts with heavy chains on Guinea Pig IgG and light chains on all Guinea Pig immunoglobulins.Purity:Min. 95%TIPIN antibody
TIPIN antibody was raised in rabbit using the N terminal of TIPIN as the immunogen
Purity:Min. 95%Donkey anti Rabbit IgG (H + L) (Alk Phos)
This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.
Purity:Min. 95%BECN1 antibody
The BECN1 antibody is a monoclonal antibody that has been specifically designed to target and bind to the BECN1 protein. This protein plays a crucial role in autophagy, which is the process by which cells break down and recycle their own components. By binding to BECN1, this antibody activates the autophagy pathway, leading to increased cell survival and improved cellular function.
Rabbit anti Rat IgG (H + L) (HRP)
Rabbit anti-rat IgG (H+L) (HRP) was raised in rabbit using rat IgG whole molecule as the immunogen.
Purity:Min. 95%Rabbit anti Bovine IgG (H + L) (Texas Red)
Rabbit anti-bovine IgG (H+L) was raised in rabbit using bovine IgG whole molecule as the immunogen.
Purity:Min. 95%ANP32B antibody
ANP32B antibody was raised using a synthetic peptide corresponding to a region with amino acids GLTAEFVNLEFLSLINVGLISVSNLPKLPKLKKLELSENRIFGGLDMLAE
HIV1 gp41 antibody
HIV1 gp41 antibody was raised in goat using recombinant ectodomain of gp41 (glycosylated) as the immunogen.Purity:Min. 95%MPP5 antibody
MPP5 antibody was raised using a synthetic peptide corresponding to a region with amino acids AVDCPGDLGTRMMPIRRSAQLERIRQQQEDMRRRREEEGKKQELDLNSSM
Phosphotyrosine antibody
The Phosphotyrosine antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically recognize and bind to phosphorylated tyrosine residues on proteins, making it an essential tool for studying kinase substrates and phosphatase activity. This antibody is particularly useful in investigating signaling pathways involving tyrosine kinase receptors, such as the epidermal growth factor receptor or colony-stimulating factor receptor.
Purity:Min. 95%KBTBD10 antibody
KBTBD10 antibody was raised in rabbit using the N terminal of KBTBD10 as the immunogen
Purity:Min. 95%HNE antibody
HNE antibody was raised in goat using 4-Hydroxynonenal protein as the immunogen.Purity:Min. 95%Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productHBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
