Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75459 products of "Primary Antibodies"
ZC3H12A antibody
The ZC3H12A antibody is a polyclonal antibody that is used in life sciences research. It has been shown to interact with various proteins and molecules, including alpha-fetoprotein, macrophage colony-stimulating factor, interferon, phosphatase, acidic glutamate, and vasoactive intestinal peptide. This antibody is commonly used in studies related to immune response and cell signaling pathways. It specifically targets the ZC3H12A protein, which is known to play a role in regulating inflammatory responses. The ZC3H12A antibody can be used for various applications such as immunohistochemistry, western blotting, and enzyme-linked immunosorbent assays (ELISA). Its high specificity and sensitivity make it a valuable tool for researchers studying immune system function and related diseases.
PTHLH antibody
PTHLH antibody was raised using the middle region of PTHLH corresponding to a region with amino acids YKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLS
Factor IX antibody (biotin)
Factor IX antibody (biotin) was raised in goat using human Factor IX purified from plasma as the immunogen.
Interferon alpha Receptor 1 antibody
The Interferon alpha Receptor 1 antibody is a highly specialized polyclonal antibody that is used in immunoassays. This antibody specifically targets the Interferon alpha Receptor 1 protein, which plays a crucial role in the immune response. It can be used for various applications, including Western blotting, immunoprecipitation, and immunohistochemistry.
PAIP1 antibody
PAIP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EPTFYTSDGVPFTAADPDYQEKYQELLEREDFFPDYEENGTDLSGAGDPY
LHR antibody
The LHR antibody is a polyclonal antibody used in life sciences research. It specifically targets the luteinizing hormone receptor (LHR), which plays a crucial role in reproductive processes. This antibody is commonly used to study the interaction between LHR and various ligands, such as chemokines, on the microvascular endothelium. It can also be used in antigen-antibody reactions to detect the presence of LHR in different tissues or cell types. The LHR antibody is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific experimental needs. With its high specificity and sensitivity, this antibody is an invaluable tool for investigating the function and regulation of LHR in various biological contexts.
Collagen Type IV antibody (biotin)
Collagen type IV antibody (biotin) was raised in rabbit using collagen type IV from human and bovine placenta as the immunogen.
DDT antibody
DDT antibody is an activated phosphatase that belongs to the class of monoclonal antibodies. It is used in life sciences research for various applications, including immunohistochemistry, Western blotting, and ELISA. DDT antibody specifically binds to DDT (dichlorodiphenyltrichloroethane), a synthetic insecticide that was widely used in the past but has since been banned due to its harmful effects on the environment and human health. This antibody can be used to detect and neutralize DDT in samples such as human serum or environmental samples. It has high affinity and specificity for DDT and does not cross-react with other compounds. The DDT antibody is conjugated with a fluorescent or enzymatic tag, allowing for easy detection and quantification of DDT in various assays.
PPIE antibody
PPIE antibody was raised using a synthetic peptide corresponding to a region with amino acids KKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKP
SSRP1 antibody
The SSRP1 antibody is a powerful tool in Life Sciences research. It specifically targets and binds to tumor necrosis factor-alpha (TNF-α) and imatinib, both of which are growth factors involved in various cellular processes. By binding to these proteins, the SSRP1 antibody can inhibit their activity and disrupt signaling pathways that promote cell growth and survival.
alpha Actin antibody
The alpha Actin antibody is a powerful tool used in Life Sciences research. It belongs to the category of antibodies, specifically polyclonal and monoclonal antibodies. This antibody is known for its neutralizing properties against fibronectin, chemokines, growth factors, and collagen. It has been extensively studied and proven to be highly specific in detecting and targeting alpha Actin, an important protein involved in cell structure and movement. The alpha Actin antibody can be used in various applications such as immunohistochemistry, western blotting, and flow cytometry to study the expression and localization of alpha Actin in different tissues and cell types. Researchers rely on this specific antibody to gain insights into cellular processes, signaling pathways, and disease mechanisms related to actin dynamics.
Ephrin A1 antibody
The Ephrin A1 antibody is a highly specialized antibody used in the field of Life Sciences. It is particularly effective against HER2, a protein that plays a crucial role in various cellular processes. This antibody has been extensively tested and has shown high affinity towards HER2, making it an ideal tool for research and diagnostic purposes.
Galectin 3 antibody
Galectin 3 antibody was raised in mouse using full length recombinant human galectin-3 as the immunogen.
MELK antibody
The MELK antibody is a highly specialized product in the field of Life Sciences. It is designed to target and neutralize the activity of Maternal Embryonic Leucine Zipper Kinase (MELK), a nuclear protein that plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be effective in inhibiting the growth and proliferation of cancer cells.
CEA antibody
The CEA antibody is a monoclonal antibody used in Life Sciences. It has pro-angiogenic activity, meaning it promotes the growth of new blood vessels. This antibody can be used in various research applications, such as immunoassays and immunohistochemistry, to detect and quantify CEA (carcinoembryonic antigen) levels. CEA is a protein that is often elevated in certain types of cancer, particularly colorectal cancer. By targeting CEA, this antibody can help researchers better understand the role of CEA in cancer development and progression. Additionally, the CEA antibody has been shown to interact with other proteins, such as annexin A2 and epidermal growth factor, suggesting potential involvement in signaling pathways related to cell growth and proliferation. With its high specificity and sensitivity, the CEA antibody is a valuable tool for studying CEA-related processes and developing diagnostic tests for cancer detection.CD22 antibody
The CD22 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target the CD22 protein, which plays a crucial role in immune response regulation. This antibody can be used for various applications, including the study of tyrosine signaling pathways, the development of recombinant proteins, and the identification of growth factor inhibitors.
S100B antibody
The S100B antibody is a highly specialized product in the field of Life Sciences. It is an antibody derived from human immunoglobulin that specifically targets the growth hormone receptor. This monoclonal antibody has been developed as a chimeric protein, which enhances its efficacy and specificity.
Eotaxin 3 antibody (biotin)
Eotaxin 3 antibody (biotin) was raised in goat using highly pure recombinant human eotaxin-3 as the immunogen.
CIAPIN1 antibody
The CIAPIN1 antibody is a highly specialized product in the field of Life Sciences. It is an antibody that specifically targets and binds to the CIAPIN1 protein. This protein has been shown to play a crucial role in various cellular processes, including cell growth, apoptosis, and immune response.
Lysozyme antibody
The Lysozyme antibody is a powerful tool in the field of Life Sciences. It is an antibody that specifically targets and detects lysozyme, an enzyme found in various biological systems. This antibody can be used in a wide range of applications, including androgen assays, immunohistochemistry, Western blotting, and ELISA.
SREBF2 antibody
SREBF2 antibody was raised in rabbit using the middle region of SREBF2 as the immunogen
CD19 antibody (Azide Free)
CD19 antibody (Azide free) was raised in mouse using human CD19 as the immunogen.
HBcAg antibody
The HBcAg antibody is a reactive antibody that is used in various applications in the field of life sciences. It is commonly used for its neutralizing properties against antiphospholipid antibodies and anti-HER2 antibodies. This polyclonal antibody has been extensively studied and has shown high specificity and affinity towards its target antigens.
MCM3 antibody
The MCM3 antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets MCM3, a protein biomarker involved in various cellular processes. This antibody can be used in immunoassay tests to detect and quantify MCM3 levels in samples, providing valuable insights into cell cycle regulation, DNA replication, and other essential biological functions.
APP antibody
The APP antibody is a powerful tool used in medical research and diagnostics. It specifically targets alpha-fetoprotein (AFP), which is an important biomarker for various diseases, including liver cancer. The APP antibody binds to amyloid plaques, which are abnormal protein deposits found in the brains of individuals with Alzheimer's disease. This antibody can also be used to study growth factors and their binding proteins, providing valuable insights into cellular processes and signaling pathways.
Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productDengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
