Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75459 products of "Primary Antibodies"
CHRND antibody
CHRND antibody was raised in rabbit using the N terminal of CHRND as the immunogen
Purity:Min. 95%Methamphetamine antibody
Methamphetamine antibody was raised in mouse using methamphetamine-BSA as the immunogen.CLDN4 antibody
The CLDN4 antibody is a monoclonal antibody that has been specifically designed to target and neutralize the activity of CLDN4, a protein that is activated in certain diseases. This antibody has shown promising results in inhibiting the growth of tumors expressing high levels of alpha-fetoprotein, a known marker for liver cancer. Additionally, the CLDN4 antibody has been found to block the chemokine signaling pathway, which plays a crucial role in cell migration and inflammation. It also acts as a serine protease inhibitor, preventing the activation of enzymes involved in tumor progression. With its high specificity and efficacy, this antibody holds great potential for therapeutic applications in the field of Life Sciences.
PDIA4 antibody
The PDIA4 antibody is a highly specific monoclonal antibody that targets the protein disulfide isomerase A4 (PDIA4). This antibody has been extensively studied for its role in various biological processes, including fatty acid metabolism, lipoprotein lipase activity, and collagen synthesis. It has also been shown to modulate the viscosity of human serum and play a crucial role in cell signaling pathways, such as hepatocyte growth factor and fibronectin signaling.
ABCA12 antibody
ABCA12 antibody was raised using a synthetic peptide corresponding to a region with amino acids TTIFKMLTGDIIPSSGNILIRNKTGSLGHVDSHSSLVGYCPQEDALDDLV
Purity:Min. 95%BRAF antibody
BRAF antibody was raised in Mouse using a purified recombinant fragment of human BRAF expressed in E. coli as the immunogen.
FKBP8 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth and prevents transcription and replication. This active compound has been extensively studied using a patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.
Goat anti Human IgG + IgA + IgM (H + L)
Goat anti-human IgG/IgA/IgM (H+L) was raised in goat using human IgG, IgA and IgM whole molecules as the immunogen.Purity:Min. 95%Rabbit anti Sheep IgG (rhodamine)
Rabbit anti-sheep IgG (Rhodamine) was raised in rabbit using sheep IgG F(c) fragment as the immunogen.
Purity:Min. 95%CRP antibody
CRP antibody was raised using the N terminal of CRP corresponding to a region with amino acids MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKA
TIPIN antibody
TIPIN antibody was raised in rabbit using the N terminal of TIPIN as the immunogen
Purity:Min. 95%CD2 antibody
The CD2 antibody is a monoclonal antibody that targets the CD2 protein, which plays a crucial role in T-cell activation and growth factor signaling. This antibody specifically binds to the activated form of CD2 and has been shown to inhibit T-cell proliferation and cytokine production. Additionally, it has hypomethylating properties, which may contribute to its anti-inflammatory effects. The CD2 antibody is commonly used in Life Sciences research for studying T-cell biology and immune responses. It can also be used in combination with other antibodies or inhibitors for antibody-drug conjugate therapy. Furthermore, this antibody has been utilized in various studies involving extracellular histones, tyrosine kinase inhibitors like imatinib, and intracellular signaling pathways such as p38 MAPK. Its versatility and specificity make it an invaluable tool for researchers in the field of immunology.
QSOX1 antibody
The QSOX1 antibody is a powerful tool in the field of life sciences. It is a polyclonal antibody that can neutralize the activity of QSOX1, an enzyme involved in the formation of disulfide bonds in proteins. This antibody recognizes a conformational epitope on QSOX1 and inhibits its function as a topoisomerase inhibitor.
FBXO24 antibody
FBXO24 antibody was raised using the middle region of FBXO24 corresponding to a region with amino acids EGKIYSLVVNETQLDQPRSYTVQLALRKVSHYLPHLRVACMTSNQSSTLY
Pirimiphos antibody
Pirimiphos antibody is a highly specialized antibody used in the field of Life Sciences. It belongs to the category of polyclonal antibodies and is commonly used for research purposes. This antibody specifically targets insulin, a hormone that plays a crucial role in regulating blood sugar levels. By binding to insulin, Pirimiphos antibody can be used to study insulin signaling pathways and its involvement in various physiological processes.
Arntl2 antibody
Arntl2 antibody was raised in rabbit using the C terminal of Arntl2 as the immunogen
Purity:Min. 95%MAG antibody
The MAG antibody is a highly specialized antibody that has various characteristics and applications. It is a DNA aptamer that acts as an active agent, capable of neutralizing the effects of SN-38, a potent cytotoxic compound. The MAG antibody can be used in various research and diagnostic applications due to its specificity and binding affinity.
EWSR1 antibody
EWSR1 antibody was raised using the N terminal of EWSR1 corresponding to a region with amino acids PQVPGSYPMQPVTAPPSYPPTSYSSTQPTSYDQSSYSQQNTYGQPSSYGQ
RAD23A antibody
RAD23A antibody was raised using a synthetic peptide corresponding to a region with amino acids GIPGSPEPEHGSVQESQVSEQPATEAAGENPLEFLRDQPQFQNMRQVIQQ
Human Growth Hormone antibody (HRP)
Human Growth Hormone antibody was raised in Rat using recombinant human growth hormone as the immunogen.
PTGS1 antibody
PTGS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LDRYQCDCTRTGYSGPNCTIPGLWTWLRNSLRPSPSFTHFLLTHGRWFWE
Flag Tag antibody
The Flag Tag antibody is a highly effective monoclonal antibody that is widely used in the field of Life Sciences. It is designed to specifically target and bind to the Flag epitope, which is a small peptide sequence commonly added to proteins for detection and purification purposes. This antibody has been extensively validated for use in various applications such as immunoassays, Western blotting, immunofluorescence, and flow cytometry. One of the key advantages of the Flag Tag antibody is its high affinity and specificity towards the Flag epitope. This ensures reliable and accurate detection of proteins carrying this tag. Additionally, the antibody exhibits minimal cross-reactivity with other commonly used tags, making it an ideal choice for researchers working with multiple protein expression systems. In addition to its exceptional performance in protein detection, the Flag Tag antibody also offers excellent stability and reproducibility. It can withstand harsh experimental conditions such as high temperatures or denaturing agents without compromising its binding efficiency. This makes it suitable for a wide range
Goat anti Llama IgG (H + L) (HRP)
This antibody reacts with heavy chains on llama IgG and light chains on all llama immunoglobulins.Purity:Min. 95%SLC10A5 antibody
SLC10A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids GYSFAKVCTLPLPVCKTVAIESGMLNSFLALAVIQLSFPQSKANLASVAP
Influenza B antibody
Influenza B antibody was raised in goat using the yamagata strain of influenza B as the immunogen.Purity:Min. 95%NMDAR1 antibody
The NMDAR1 antibody is a monoclonal antibody that targets the N-methyl-D-aspartate receptor subtype 1 (NMDAR1). This receptor is involved in various physiological processes, including synaptic plasticity and learning. The NMDAR1 antibody has been shown to inhibit the activation of NMDAR1 and reduce microvessel density in tumors by blocking the binding of growth factors to their receptors. It has also been demonstrated to modulate the expression of histidine, epidermal growth factor, and steroid receptors in granulosa cells. In addition, this antibody can activate e-cadherin and β-catenin signaling pathways, which are important for cell adhesion and migration. Overall, the NMDAR1 antibody offers promising applications in life sciences research and provides valuable insights into cellular mechanisms related to growth and development.
AQP1 antibody
The AQP1 antibody is a monoclonal antibody that targets the aquaporin-1 (AQP1) protein. Aquaporins are a family of water channel proteins that play a crucial role in regulating water transport across cell membranes. AQP1 is specifically expressed in endothelial cells, where it facilitates the movement of water and small solutes across blood vessels.
PDGF Receptor alpha antibody
PDGF receptor alpha antibody was raised in rabbit using peptide corresponding to amino acids 1035-1053 (C-GKRNRHSSQTSEESAIETG) of human PDGF Receptor slpha as the immunogen.Purity:Min. 95%Anti-HIV p24 antibody
The Anti-HIV p24 antibody is a powerful tool in the fight against HIV. This monoclonal antibody specifically targets the p24 protein, which is an essential component of the HIV virus. By binding to this protein, the antibody prevents the virus from replicating and spreading throughout the body. In addition to its antiviral properties, the Anti-HIV p24 antibody has been shown to have other beneficial effects. It has been found to inhibit epidermal growth factor signaling, which is involved in cell proliferation and survival. This can help prevent the spread of cancer cells and may have potential applications in cancer treatment. Furthermore, studies have shown that this antibody can enhance the effectiveness of other targeted therapies, such as trastuzumab for HER2-positive breast cancer. By combining these treatments, researchers have observed improved outcomes and increased patient survival rates. The Anti-HIV p24 antibody also has potential diagnostic applications. It can be used in laboratory tests to detect the presence of HIV infection by binding
GPR1 antibody
The GPR1 antibody is a monoclonal antibody that specifically targets the epidermal growth factor receptor (EGFR). It belongs to the family of EGFR-like antibodies and has been shown to have neutralizing effects on the activity of EGFR. This antibody can be used in various research applications, including immunohistochemistry and Western blotting, to study the role of EGFR in cell signaling pathways. Additionally, the GPR1 antibody has been used to investigate the interactions between EGFR and other molecules, such as fibronectin and chemokines. Its high specificity and affinity make it a valuable tool for researchers in the field of life sciences studying growth factors and their associated signaling pathways.
HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productCA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
