Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75448 products of "Primary Antibodies"
YBX1 antibody
The YBX1 antibody is a highly specialized diagnostic reagent used in the field of Life Sciences. It is an antibody that specifically targets the YBX1 protein, which plays a crucial role in various cellular functions including protein-protein interactions and regulation of gene expression. This antibody can be used in flow immunoassays to detect the presence of YBX1 in human serum or other biological samples.
IGF2BP2 antibody
The IGF2BP2 antibody is a highly specialized antibody that targets the transferrin receptor in the nucleus of cells. This antibody is widely used in Life Sciences research to study various cellular processes, including exocytosis, cell signaling, and protein synthesis. The IGF2BP2 antibody specifically binds to the antigen on the cell surface and facilitates the internalization of transferrin into the cell. This process is crucial for proper iron metabolism and cellular homeostasis. Additionally, this monoclonal antibody has been shown to have antimicrobial properties against certain bacteria, such as those expressing alpha-gal epitopes. Its unique mechanism of action involves targeting bacterial phosphatases and inhibiting their activity, leading to impaired bacterial growth. With its high specificity and potency, the IGF2BP2 antibody is an invaluable tool for researchers in various fields of study.
Goat anti-Human IgG antibody
The Goat anti-Human IgG antibody is a powerful tool used in Life Sciences research. This monoclonal antibody specifically targets and neutralizes human IgG, making it an essential component for various applications.
C20ORF144 antibody
C20ORF144 antibody was raised using the middle region of C20Orf144 corresponding to a region with amino acids EARRPEEGGARAALSWPRLLSRFRSPGKAPREAGPAEEQPRKRCRCPRPQ
Goat anti Mouse IgM (Fab'2)
Goat anti-mouse IgM (Fab'2) was raised in goat using murine IgM mu heavy chain as the immunogen.
Purity:Min. 95%CD4 antibody (PE)
CD4 antibody (PE) was raised in mouse using P815 cell transfected with human CD4 as the immunogen.
AChE antibody
The AChE antibody is a highly specific antibody used in life sciences research. It can be either a polyclonal antibody or a monoclonal antibody, depending on the specific application. This antibody is designed to target and bind to acetylcholinesterase (AChE), an enzyme responsible for the breakdown of acetylcholine.
CCR5 antibody
The CCR5 antibody is a monoclonal antibody that has been widely used in Life Sciences research. It targets the CCR5 receptor, a glycoprotein found on the surface of immune cells. This antibody has been shown to have neutralizing effects on CCR5, blocking its interaction with the ligands and inhibiting viral entry into host cells. It has been used in various immunoassays and hybridoma cell studies to investigate the role of CCR5 in immune response and disease progression. Additionally, this antibody has been utilized for its potential antiviral properties, particularly against HIV-1 strains that use CCR5 as a co-receptor for viral entry. Its specificity and high affinity make it a valuable tool for studying CCR5-related signaling pathways and developing therapeutic strategies targeting this receptor.
CD25 antibody (PE-CY7)
CD25 antibody (PE-CY7) was raised in rat using IL-2-dependent BALB/c mouse helper T-cell clone HT-2 as the immunogen.
Purity:Min. 95%Molecular weight:0 g/molTCF25 antibody
TCF25 antibody was raised in rabbit using the N terminal of TCF25 as the immunogen
Purity:Min. 95%Transferrin antibody
Transferrin antibody was raised in rabbit using human transferrin as the immunogen.
Purity:Min. 95%PRLR antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug from the class of rifamycins. It is highly effective in treating tuberculosis infections, as it exhibits strong bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, preventing transcription and replication of bacteria. Its efficacy has been demonstrated through the use of advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their growth. Experience the power of 6-Fluoro-3-indoxyl-beta-D-galactopyranoside for effective treatment against tuberculosis.Purity:Min. 95%PKC alpha antibody
The PKC alpha antibody is a powerful tool used in Life Sciences research. It is a monoclonal antibody that specifically targets and binds to protein kinase C alpha (PKC alpha), an enzyme involved in various cellular processes. This antibody has been extensively tested and validated for its specificity and sensitivity.
NNMT antibody
The NNMT antibody is a highly effective medicament used in the field of Life Sciences. It is specifically designed to target and bind to the NNMT protein, enabling researchers to study its functions and interactions in various biological processes. This monoclonal antibody exhibits a strong antigen-antibody reaction, allowing for precise detection and analysis of NNMT in samples.
SLC18A2 antibody
The SLC18A2 antibody is a monoclonal antibody that specifically targets the protein encoded by the SLC18A2 gene. This gene encodes a glycoprotein that functions as a vesicular monoamine transporter, responsible for transporting neurotransmitters such as dopamine, norepinephrine, and serotonin into synaptic vesicles. The SLC18A2 antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications.SCF antibody
The SCF antibody is a highly specialized monoclonal antibody that plays a crucial role in inhibiting the endocytic uptake of growth factors such as collagen and fatty acids. This antibody acts as a neutralizing agent and specifically targets the low-density lipoprotein receptor-related protein (LRP), preventing its activation by interfering with its binding to growth factors. By blocking this interaction, the SCF antibody effectively hinders the downstream signaling pathways involved in cell proliferation and differentiation.
Caveolin 1 antibody
The Caveolin 1 antibody is a highly specialized monoclonal antibody that targets tyrosine residues on the Caveolin 1 protein. This protein plays a crucial role in cellular processes such as growth factor signaling and receptor internalization. By binding to Caveolin 1, this antibody inhibits its function, leading to cytotoxic effects on cancer cells.
Purity:Min. 95%IpaD antibody
The IpaD antibody is a glycoprotein that has denaturing properties. It is known for its neuroprotective and neutralizing effects. This high polymer glycan has been found to interact with hormone peptides and collagens. The IpaD antibody is produced through the use of monoclonal antibodies, which are created through recombinant techniques. Its glycosylation plays a crucial role in its functionality. It should be noted that this antibody may have teratogenic effects and caution should be exercised when using it. The IpaD antibody is commonly used in research and diagnostic applications due to its specificity and affinity for its target antigen.GST antibody
The GST antibody is a highly effective inhibitor that belongs to the class of monoclonal antibodies. It is widely used in Life Sciences research for various applications. This antibody specifically targets and binds to glutathione S-transferase (GST), a glycoprotein commonly used as a fusion tag in protein purification and detection assays. The GST antibody can be immobilized on an electrode or streptavidin-coated surface for use in immunoassays, electrophoresis, or other experimental techniques. Additionally, this antibody has shown promising results in the treatment and/or prophylaxis of certain diseases, including its potential anti-angiogenesis effects. Its specificity and high affinity make it an invaluable tool for researchers studying GST-related processes or developing diagnostic tests using human serum samples.
ATF2 antibody
The ATF2 antibody is a highly specialized product used in the field of Life Sciences. It is available in both polyclonal and monoclonal forms, making it suitable for a wide range of applications. This antibody specifically targets ATF2, a transcription factor involved in various cellular processes such as DNA repair and apoptosis.
ELAVL4 antibody
ELAVL4 antibody was raised using the N terminal of ELAVL4 corresponding to a region with amino acids MQTGATTDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITG
IFNAR1 antibody
The IFNAR1 antibody is a highly specific monoclonal antibody used in Life Sciences research. It is designed to target and bind to the IFNAR1 protein, which plays a crucial role in the immune response. This antibody has been extensively tested and validated for its efficacy in various applications, including Western blotting, immunoprecipitation, and immunofluorescence.
Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productDengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
