Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
MYH10 antibody
MYH10 antibody was raised using the N terminal of MYH10 corresponding to a region with amino acids WFPKATDKTFVEKLVQEQGSHSKFQKPRQLKDKADFCIIHYAGKVDYKAD
Goat anti Llama IgG (H + L) (HRP)
This antibody reacts with heavy chains on llama IgG and light chains on all llama immunoglobulins.Purity:Min. 95%FER antibody
The FER antibody is a powerful tool used in life sciences research for the detection and analysis of messenger RNA (mRNA). It belongs to the category of antibodies, specifically polyclonal antibodies. This cytotoxic antibody is designed to target specific proteins, particularly glycoproteins, and can be used for various applications such as protein immobilization and chromatographic purification. The FER antibody has the unique ability to neutralize binding proteins, including growth factors like hepatocyte growth factor and angiopoietin-like 3 (ANGPTL3). Its high specificity and sensitivity make it an invaluable asset in the field of molecular biology and biomedical research.
IGFBP3 antibody
IGFBP3 antibody is a stable chemical compound that plays a crucial role in the field of Life Sciences. It is a monoclonal antibody that specifically targets and neutralizes IGFBP3, which stands for insulin-like growth factor binding protein 3. This antibody has been extensively used in research and diagnostics to study the aberrant methylation and oxidative damage associated with IGFBP3.
Selenophosphate synthetase 1 antibody
Affinity purified Rabbit polyclonal Selenophosphate synthetase 1 antibody
PDGF Receptor alpha antibody
PDGF receptor alpha antibody was raised in rabbit using peptide corresponding to amino acids 1035-1053 (C-GKRNRHSSQTSEESAIETG) of human PDGF Receptor slpha as the immunogen.Purity:Min. 95%PPP4C antibody
PPP4C antibody was raised using a synthetic peptide corresponding to a region with amino acids TVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKKP
PARVB antibody
PARVB antibody was raised using the C terminal of PARVB corresponding to a region with amino acids HNVSFAFELMLDGGLKKPKARPEDVVNLDLKSTLRVLYNLFTKYKNVEPurity:Min. 95%CEA antibody
The CEA antibody is a powerful growth factor that plays a crucial role in various biological processes. It interacts with transferrin and TNF-α to regulate hepatocyte growth and function. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications. One notable application is its use as a targeted therapy. The CEA antibody, when conjugated with other therapeutic agents such as trastuzumab (anti-HER2 antibody), can specifically target cancer cells that overexpress certain markers, leading to their selective destruction. This targeted approach minimizes damage to healthy cells and reduces side effects. Additionally, the CEA antibody has been found to be an effective tool in research and diagnostics. It can be used as an activated electrode for the detection of specific biomarkers, such as annexin or chemokines, allowing for precise measurements and analysis. Moreover, monoclonal antibodies against CEA have been developed for the detection and quantification of CEA levels
GOLM1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside, also known as Rifapentine, is a powerful antituberculosis drug from the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, Rifapentine inhibits bacterial growth by preventing transcription and replication. This active compound has been extensively studied using advanced techniques like the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Rifapentine specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.
RPS3 antibody
The RPS3 antibody is a monoclonal antibody that specifically targets the tyrosine kinase receptor. It has been shown to have cytotoxic effects when used in combination with doxorubicin, a commonly used chemotherapy drug. The RPS3 antibody works by binding to the receptor and activating downstream signaling pathways that lead to cell death. Additionally, this antibody has been found to inhibit the production of tumor necrosis factor-alpha (TNF-α), a cytokine involved in inflammation and immune response. Furthermore, the RPS3 antibody has been shown to neutralize extracellular histones, which are released during cell death and can cause tissue damage. This highly specific and potent antibody is an essential tool for researchers in the life sciences field studying growth factors and tyrosine kinase receptors. Whether you're conducting experiments or developing new therapeutics, the RPS3 antibody is a valuable asset for your research endeavors.
BNP antibody
The BNP antibody is a monoclonal antibody that specifically targets brain natriuretic peptide (BNP). It is designed to neutralize the activity of BNP in human serum. The antibody can be used in various assays and tests, including electrode-based assays, to measure the levels of BNP. Brain natriuretic peptide is a hormone that is involved in regulating blood pressure and fluid balance. By targeting BNP, this antibody can help researchers and clinicians better understand its role in various physiological processes. Additionally, the BNP antibody may have potential therapeutic applications as an antibody-drug conjugate or as a tool for studying tissue transglutaminase and other membrane-spanning polypeptides. With its high specificity and affinity for BNP, this monoclonal antibody offers a valuable tool for research and diagnostic purposes.IL18 antibody
IL18 antibody is a monoclonal antibody that acts as a medicament to target specific proteins in the body. It has cytotoxic properties, meaning it can destroy targeted cells or inhibit their growth. IL18 antibody specifically targets plasminogen activator receptor and alpha-fetoprotein, which are proteins involved in various biological processes. By binding to these proteins, IL18 antibody neutralizes their function and prevents them from carrying out their normal activities.
HAO1 antibody
HAO1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLNGILVSNHGARQLDGVPATIDVLPEIVEAVEGKVEVFLDGGVRKGTDV
Troponin T antibody
The Troponin T antibody is an immunosuppressant that belongs to the group of polyclonal antibodies. It specifically targets calmodulin, a protein involved in muscle contraction and relaxation. This antibody is buffered and has neutralizing properties, making it highly effective in inhibiting the activity of calmodulin. In addition to its immunosuppressive effects, the Troponin T antibody has been shown to promote the growth of factors that regulate cell proliferation and differentiation. It also exhibits diuretic properties by enhancing the excretion of fluids from the body. This antibody is widely used in life sciences research, particularly in studies involving interleukin-6 and other cytokines. The Troponin T antibody is available as a monoclonal antibody, which ensures high specificity and affinity for its target antigen. Its versatility extends beyond research applications, as it can also be used for diagnostic purposes, such as detecting influenza hemagglutinin or monitoring signaling pathways involving PI3-kinase
RALGPS2 antibody
RALGPS2 antibody was raised using the C terminal of RALGPS2 corresponding to a region with amino acids YLGIYLSDLTYIDSAYPSTGSILENEQRSNLMNNILRIISDLQQSCEYDI
SMAD3 antibody
The SMAD3 antibody is a glycoprotein that acts as a growth factor and plays a crucial role in various cellular processes. It is a monoclonal antibody specifically designed to target SMAD3, which is involved in signal transduction pathways related to cell proliferation and differentiation. This antibody can be used for various applications such as immunohistochemistry, Western blotting, and flow cytometry.
Purity:Min. 95%ICAM1 antibody
ICAM1 antibody was raised in Mouse using a purified recombinant fragment of human ICAM1(28-480aa) expressed in E. coli as the immunogen.Septin 10 antibody
Septin 10 antibody was raised using the C terminal of 40431 corresponding to a region with amino acids ERMKLEEKRRLLEEEIIAFSKKKATSEIFHSQSFLATGSNLRKDKDRKNS
ADP ribosylation factor 3 antibody
Affinity purified Rabbit polyclonal ADP ribosylation factor 3 antibody
Rat Macrophage antibody
Rat macrophage antibody was raised in rabbit using rat macrophages as the immunogen.Purity:Min. 95%TBC1D16 antibody
TBC1D16 antibody was raised using the middle region of TBC1D16 corresponding to a region with amino acids RGEVWPFLLRYYSHESTSEEREALRLQKRKEYSEIQQKRLSMTPEEHRAF
Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productHBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
