Primary Antibodies

Factor VII antibody is a polyclonal antibody that targets the activated form of factor VII, a surface glycoprotein involved in the coagulation cascade. This antibody has been widely used in life sciences research to study the role of factor VII in various physiological processes. It has been shown to inhibit factor VII activity and gluconeogenesis in vitro. Additionally, this antibody has been used as a tool in multi-agent chemotherapy studies to investigate its potential therapeutic effects. Factor VII antibody can be used in various applications such as immunoassays, electrophoresis, and Western blotting to detect and quantify factor VII levels in samples. Its high specificity and sensitivity make it an essential tool for researchers studying coagulation pathways and related disorders.

Rabbit polyclonal TLR2 antibody (Middle Region)

The HIPK2 antibody is a highly specialized tool used in Life Sciences research. It is a Polyclonal Antibody that is designed for the ultrasensitive detection and neutralization of clostridial neurotoxins. The antibody can be immobilized on a carbon electrode, allowing for electrochemical impedance spectroscopy to be performed. This technique enables researchers to accurately measure the presence and activity of the toxins in various samples.

ACTA1 antibody was raised in rabbit using the N terminal of ACTA1 as the immunogen

The DKK3 antibody is a polyclonal antibody that specifically targets the glycoprotein DKK3. It is commonly used in life sciences research to study the role of DKK3 in various biological processes. This antibody has been shown to have neuroprotective properties and can inhibit cytotoxic effects induced by insulin. Additionally, it has been found to possess anticoagulant activity and can bind to phospholipids, making it useful for studying antiphospholipid antibodies. The DKK3 antibody is a valuable tool for researchers investigating the function and therapeutic potential of DKK3 in different contexts.

Affinity purified Rabbit polyclonal Tetraspan 1 antibody

Rabbit polyclonal CYC1 antibody (HRP)

IL6 antibody is a monoclonal antibody that specifically targets interleukin-6 (IL-6), a pro-inflammatory cytokine involved in various immune responses. IL-6 plays a crucial role in inflammation, autoimmune disorders, and cancer progression. The IL6 antibody binds to IL-6, neutralizing its activity and preventing it from binding to its receptors.

IFI44L antibody was raised using the N terminal of IFI44L corresponding to a region with amino acids MEVTTRLTWNDENHLRKLLGNVSLSLLYKSSVHGGSIEDMVERCSRQGCT

Affinity purified Rabbit polyclonal PSCDBP antibody

Rabbit polyclonal DGKQ antibody

ACADVL antibody was raised in Rabbit using Human ACADVL as the immunogen

Tetraspanin 32 antibody was raised using the middle region of TSPAN32 corresponding to a region with amino acids EDCLQGIRSFLRTHQQVASSLTSIGLALTVSALLFSSFLWFAIRCGCSLD

CCNE2 antibody was raised in rabbit using the N terminal of CCNE2 as the immunogen

Affinity purified Rabbit polyclonal IP6K1 antibody

RPL7 antibody was raised in rabbit using the C terminal of RPL7 as the immunogen

PTHLH antibody was raised using the middle region of PTHLH corresponding to a region with amino acids YKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLS

Factor IX antibody (biotin) was raised in goat using human Factor IX purified from plasma as the immunogen.

The Interferon alpha Receptor 1 antibody is a highly specialized polyclonal antibody that is used in immunoassays. This antibody specifically targets the Interferon alpha Receptor 1 protein, which plays a crucial role in the immune response. It can be used for various applications, including Western blotting, immunoprecipitation, and immunohistochemistry.

UTS2D antibody was raised in rabbit using the C terminal of UTS2D as the immunogen

CD45.2 antibody was raised in mouse using CD45.2 as the immunogen.

PAIP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EPTFYTSDGVPFTAADPDYQEKYQELLEREDFFPDYEENGTDLSGAGDPY

The LHR antibody is a polyclonal antibody used in life sciences research. It specifically targets the luteinizing hormone receptor (LHR), which plays a crucial role in reproductive processes. This antibody is commonly used to study the interaction between LHR and various ligands, such as chemokines, on the microvascular endothelium. It can also be used in antigen-antibody reactions to detect the presence of LHR in different tissues or cell types. The LHR antibody is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific experimental needs. With its high specificity and sensitivity, this antibody is an invaluable tool for investigating the function and regulation of LHR in various biological contexts.

CHMP1B antibody was raised in Rabbit using Human CHMP1B as the immunogen

Collagen type IV antibody (biotin) was raised in rabbit using collagen type IV from human and bovine placenta as the immunogen.

DDT antibody is an activated phosphatase that belongs to the class of monoclonal antibodies. It is used in life sciences research for various applications, including immunohistochemistry, Western blotting, and ELISA. DDT antibody specifically binds to DDT (dichlorodiphenyltrichloroethane), a synthetic insecticide that was widely used in the past but has since been banned due to its harmful effects on the environment and human health. This antibody can be used to detect and neutralize DDT in samples such as human serum or environmental samples. It has high affinity and specificity for DDT and does not cross-react with other compounds. The DDT antibody is conjugated with a fluorescent or enzymatic tag, allowing for easy detection and quantification of DDT in various assays.

Affinity purified Rabbit polyclonal Neuregulin 2 antibody

Affinity purified Mouse polyclonal XRCC1 antibody

Purified Polyclonal DUSP16 antibody

The MVD antibody is a highly specialized monoclonal antibody that targets the protein MVD (mevalonate diphosphate decarboxylase). This antibody is commonly used in Life Sciences research to study the function and regulation of MVD in various biological processes. It has been shown to interact with interleukin-6, chemokines, and nuclear proteins, indicating its involvement in immune responses and cellular signaling pathways.

EPS15L1 antibody was raised in Rabbit using Human EPS15L1 as the immunogen

Rabbit polyclonal GRM5 antibody

DCX antibody was raised in Rabbit using Human DCX as the immunogen

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for its growth. This bactericidal activity is achieved by binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication. Extensive research has been conducted using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique to confirm its high efficacy on human erythrocytes. Metabolically, this drug undergoes various transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it exhibits a strong affinity for markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture. Experience the power of 6-Fluoro

The Ibuprofen antibody is a highly specialized antibody that targets and binds to Ibuprofen, a popular nonsteroidal anti-inflammatory drug (NSAID). This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications.

The NOD2 antibody is a highly specialized protein used in the field of Life Sciences. It acts as an inhibitory factor for growth factors such as epidermal growth factor and hepatocyte growth factor. This monoclonal antibody specifically targets NOD2, a receptor involved in immune responses and inflammation. By binding to NOD2, the antibody blocks its function and prevents the activation of downstream signaling pathways. This antibody has been extensively studied and shown to be effective in various research applications, including the study of autoimmune diseases, cancer biology, and immunology. Whether you need a polyclonal or monoclonal antibody, our high-quality NOD2 antibodies are reliable tools for your research needs.

Claudin 17 antibody was raised using the middle region of CLDN17 corresponding to a region with amino acids KQVQCTGSNERAKAYLLGTSGVLFILTGIFVLIPVSWTANIIIRDFYNPA

ACTR10 antibody was raised in Rabbit using Human ACTR10 as the immunogen

RPE antibody was raised using the middle region of RPE corresponding to a region with amino acids MMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIK

FARS2 antibody was raised using the N terminal of FARS2 corresponding to a region with amino acids VELLGKSYPQDDHSNLTRKVLTRVGRNLHNQQHHPLWLIKERVKEHFYKQ

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.