Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75448 products of "Primary Antibodies"
ALOX15B antibody
ALOX15B antibody was raised using the N terminal of ALOX15B corresponding to a region with amino acids MAEFRVRVSTGEAFGAGTWDKVSVSIVGTRGESPPLPLDNLGKEFTAGAE
Rabbit anti Mouse IgG2b (HRP)
Rabbit anti-mouse IgG2b (HRP) was raised in rabbit using murine IgG2b heavy chain as the immunogen.
Rabbit anti Rat IgM (HRP)
Rabbit anti-rat IgM (HRP) was raised in rabbit using rat IgM mu heavy chain as the immunogen.Purity:Min. 95%Human Serum Albumin antibody (biotin)
Human serum albumin antibody (HRP) was raised in rabbit using human serum albumin as the immunogen.
CTNNB1 antibody
CTNNB1 antibody was raised in rabbit using the C terminal of CTNNB1 as the immunogen
Purity:Min. 95%Caspase 8 antibody
The Caspase 8 antibody is a polyclonal antibody used in life sciences. It specifically targets caspase 8, a cysteine-rich protein that plays a crucial role in apoptosis (programmed cell death). This glycoprotein is an important regulator of cell survival and death pathways. The Caspase 8 antibody can be used for various applications, including western blotting, immunohistochemistry, and flow cytometry.
CD82 antibody
The CD82 antibody is a powerful tool in the field of Life Sciences. It acts as a phosphatase that regulates various cellular processes by binding to specific proteins. This antibody has been shown to inhibit the production of interleukin-6, a pro-inflammatory cytokine involved in immune responses. Additionally, it can be used in antigen-antibody reactions to detect the presence of autoantibodies in patient samples.
Rabbit anti Dog IgG (H + L) (Alk Phos)
Rabbit anti-dog IgG (H+L) (Alk Phos) was raised in rabbit using canine IgG whole molecule as the immunogen.Purity:Min. 95%FZD6 antibody
The FZD6 antibody is a highly specialized monoclonal antibody that targets the insulin-like growth factor receptor (IGF-1R). It is designed to specifically bind to the IGF-1R and inhibit its activity. This antibody has shown promising results in preclinical studies, demonstrating its potential as a therapeutic agent for various diseases, including cancer.
STK11 antibody
STK11 antibody was raised using the N terminal of STK11 corresponding to a region with amino acids TLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNE
Met antibody
Met antibody is a polyclonal antibody that specifically targets the tyrosine kinase receptor known as c-Met. This antibody has neutralizing properties, meaning it can inhibit the activity of c-Met and its downstream signaling pathways. By binding to the protein complex formed by c-Met and its ligand, this antibody prevents the activation of various cellular processes involved in cell growth, survival, migration, and invasion.
Purity:Min. 95%SLC12A2 antibody
SLC12A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids IIAFEEIIEPYRLHEDDKEQDIADKMKEDEPWRITDNELELYKTKTYRQI
BD3 antibody
BD3 antibody was raised in rabbit using highly pure recombinant human BD-3 as the immunogen.Purity:Min. 95%PHTF1 antibody
PHTF1 antibody was raised in mouse using recombinant Putative Homeodomain Transcription Factor 1ABCB1 antibody
ABCB1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purity:Min. 95%Goat anti-Human IgG antibody
The Goat anti-Human IgG antibody is a powerful tool used in Life Sciences research. This monoclonal antibody specifically targets and neutralizes human IgG, making it an essential component for various applications.
Mouse Thrombocyte antibody (FITC)
Mouse thrombocyte antibody (FITC) was raised in rabbit using RBC-free mouse thymocytes as the immunogen.
OCT4 antibody
OCT4 antibody was raised in Mouse using a purified recombinant fragment of OCT4(aa193-360) expressed in E. coli as the immunogen.
DNase I antibody
The DNase I antibody is a powerful medicament used in immunohistochemistry. It belongs to the class of Polyclonal Antibodies, which are known for their high specificity and affinity. This antibody specifically targets tyrosine residues on collagen, growth factors, and membrane-spanning polypeptides. It can be used in various Life Sciences applications, including research and diagnostic purposes.
STAT1 antibody
The STAT1 antibody is a specific antibody used in life sciences research. It targets the STAT1 protein, which plays a crucial role in various cellular processes such as immune response and cell growth. This monoclonal antibody can be used to study the activation of p38 MAPK signaling pathway and its effects on mesenchymal stem cells. Additionally, it has been shown to neutralize the effects of hepcidin, a key regulator of iron metabolism. The STAT1 antibody can also be used to investigate the role of interleukin-6 and cannabinoid receptors in different biological systems. Its genotoxic properties make it an essential tool for studying DNA damage and repair mechanisms. With its high specificity and potency, this antibody is widely used by researchers in various fields of life sciences.
CGRP antibody
CGRP antibody was raised in guinea pig using synthetic human calcitonin gene related peptide as the immunogen.
Purity:Min. 95%WDSUB1 antibody
WDSUB1 antibody was raised using the middle region of WDSUB1 corresponding to a region with amino acids KVKSLSSGIPDEFICPITRELMKDPVIASDGYSYEKEAMENWISKKKRTS
Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productDengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
