Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
FBXO24 antibody
FBXO24 antibody was raised using the N terminal of FBXO24 corresponding to a region with amino acids VCDGEGVWRRICRRLSPRLQDQDTKGLYFQAFGGRRRCLSKSVAPLLAHG
WNT16 antibody
WNT16 antibody was raised using the middle region of WNT16 corresponding to a region with amino acids KTKRKMRRREKDQRKIPIHKDDLLYVNKSPNYCVEDKKLGIPGTQGRECN
API5 antibody
The API5 antibody is an adeno-associated polypeptide that has the ability to bind to antigenic proteins and inhibit their activity. It is commonly used as a research tool in the development of inhibitors for various diseases. The API5 antibody has been shown to have a high affinity for heparin, which makes it an effective compound for inhibiting heparin cofactor activity. Additionally, this antibody can be used in the production of polyclonal antibodies, which are essential tools in biomedical research. It is also known to have autoantibodies properties and can be utilized in the development of medicines targeting serotonin-related disorders.
Cat IgG Purified
The purified Cat IgG h+l can be utilized for ELISA, Western Blot and as a Blocking Agent. Please inquire for bulk pricing.
CD11b antibody (Spectral Red)
CD11b antibody (CY5) was raised in rat using C57BL/10 murine splenic T-cells and concanavalin A-activted C57BL/10 splenocytes as the immunogen.
Purity:Min. 95%IGJ antibody
The IGJ antibody is a monoclonal antibody that specifically targets insulins. It is cytotoxic and works by binding to insulin molecules, rendering them inactive. This colloidal antibody has neutralizing properties, meaning it can effectively counteract the effects of autoantibodies that may be present in the body. The IGJ antibody is designed to target specific amino acid residues on insulin, ensuring precise and effective binding. It has been extensively tested in Life Sciences research and has shown high affinity for insulin in human serum samples. With its histidine-rich structure, this monoclonal antibody offers a reliable tool for studying insulin-related processes and mechanisms.
Goat anti Llama IgG (H + L) (HRP)
This antibody reacts with heavy chains on llama IgG and light chains on all llama immunoglobulins.Purity:Min. 95%TMEM24 antibody
TMEM24 antibody was raised using the C terminal Of Tmem24 corresponding to a region with amino acids AGLSQSHDDLSNATATPSVRKKAGSFSRRLIKRFSFKSKPKANGNPSPQL
Purity:Min. 95%PDGF Receptor alpha antibody
PDGF receptor alpha antibody was raised in rabbit using peptide corresponding to amino acids 1035-1053 (C-GKRNRHSSQTSEESAIETG) of human PDGF Receptor slpha as the immunogen.Purity:Min. 95%CD4 antibody (allophycocyanin)
Mouse monoclonal CD4 antibody (allophycocyanin); human target; IgG1 kappa; clone RPA-T4
RORA antibody
RORA antibody was raised using the middle region of RORA corresponding to a region with amino acids GHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFP
MTIF3 antibody
MTIF3 antibody was raised using the middle region of MTIF3 corresponding to a region with amino acids AVQGGKALMCVLRALSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ
GAPDH antibody
The GAPDH antibody is a highly effective monoclonal antibody that has been activated to target specific proteins in the body. It is commonly used in Life Sciences research to study various cellular processes and pathways. This antibody has been found to neutralize the activity of TGF-beta, a protein involved in cell growth and differentiation. Additionally, it has shown to have glycosylation properties, which can impact protein function and stability. One of the key targets of the GAPDH antibody is E-cadherin, a protein responsible for cell adhesion and tissue integrity. By binding to E-cadherin, this antibody can modulate cell-cell interactions and potentially influence cellular behavior. Furthermore, studies have demonstrated that the GAPDH antibody can inhibit collagen production, which is crucial for maintaining tissue structure and elasticity. This property may have implications in wound healing and tissue regeneration. Another important aspect of the GAPDH antibody is its ability to regulate microvessel density. By targeting specific proteins involved in angiogenesis, this4EBP1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections as it exhibits bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, inhibiting bacterial growth and preventing transcription and replication. Its potency has been demonstrated through a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.
FZD9 antibody
FZD9 antibody was raised using a synthetic peptide corresponding to a region with amino acids TRNDPHALCMEAPENATAGPAEPHKGLGMLPVAPRPARPPGDLGPGAGGSPurity:Min. 95%Sheep anti Rabbit IgG (H + L) (Alk Phos)
Sheep anti-rabbit IgG (H+L) (Alk Phos) was raised in sheep using rabbit IgG whole molecule as the immunogen.Purity:Min. 95%CDY1 antibody
CDY1 antibody was raised using the C terminal of CDY1 corresponding to a region with amino acids FPRTWWQSAEDVHREKIQLDLEAEFYFTHLIVMFKSPRPAAMVLDRSQDF
ETFA antibody
ETFA antibody was raised using a synthetic peptide corresponding to a region with amino acids VVSGGRGLKSGENFKLLYDLADQLHAAVGASRAAVDAGFVPNDMQVGQTG
AFP antibody
AFP antibody was raised in mouse using purified human alpha-fetoprotein as the immunogen.
RBP1 antibody
The RBP1 antibody is a highly specialized polyclonal antibody that is used in various life sciences assays. It is specifically designed to target and bind to the RBP1 protein, which plays a crucial role in glucose transportation and dopamine regulation. This antibody is produced by immunizing animals with the specific antigen, resulting in the generation of high-affinity antibodies that can recognize and bind to the target protein.
SLC27A2 antibody
SLC27A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLFRDETLTYAQVDRRSNQVARALHDHLGLRQGDCVALLMGNEPAYVWLW
Purity:Min. 95%anti-Salmonella Typhimurium LPS Monoclonal
Monoclonal antibody to Salmonella typhimurium (LPS-lipopolysaccharide).Purity:Min. 95%DNA polymerase delta cat antibody
Affinity purified Rabbit polyclonal DNA polymerase delta cat antibody
Adenosine Deaminase antibody
The Adenosine Deaminase antibody is a highly specialized biomolecule used in Life Sciences research. It is available as both a monoclonal and polyclonal antibody, making it versatile for various applications. This antibody specifically targets and binds to adenosine deaminase, an enzyme involved in the breakdown of adenosine.
CLPP antibody
The CLPP antibody is a monoclonal antibody that specifically targets the CLPP protein. This glycoprotein plays a crucial role in various biological processes and has been extensively studied in the field of Life Sciences. The CLPP antibody recognizes and binds to the histidine residues on the CLPP protein, allowing for accurate detection and analysis.
CD19 antibody (Allophycocyanin)
CD19 antibody (Allophycocyanin) was raised in rat using murine CD19-expressing K562 human erythroleukemia cells as the immunogen.
Purity:Min. 95%CD8B antibody
CD8B antibody was raised using the N terminal of CD8B corresponding to a region with amino acids RIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFI
Purity:Min. 95%Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productHBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
