Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
ALK antibody
The ALK antibody is a highly effective multidrug that is commonly used in immunoassays. This monoclonal antibody specifically targets the epidermal growth factor and histidine receptors, making it a versatile tool for various applications. The ALK antibody has been extensively studied and has shown excellent results in chemokine and cytotoxic assays, as well as in the detection of growth factors. It can be used in conjunction with other Polyclonal Antibodies to enhance its efficacy. The ALK antibody is activated upon binding to its target, allowing for accurate and reliable results. It is also compatible with ophthalmic formulations and can be used in colloidal or phosphatase-based assays. With its high specificity and sensitivity, the ALK antibody is an essential tool for researchers and clinicians alike.
NELL2 antibody
NELL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MESRVLLRTFCLIFGLGAVWGLGVDPSLQIDVLTELELGESTTGVRQVPG
PD1 antibody
PD1 antibody is a protein that belongs to the family of antibodies. It plays a crucial role in regulating the immune response and preventing autoimmune diseases. PD1 antibody binds to the programmed cell death protein 1 (PD-1), which is expressed on the surface of T cells, B cells, and other immune cells. By binding to PD-1, this antibody blocks its interaction with programmed death-ligand 1 (PD-L1) and programmed death-ligand 2 (PD-L2), inhibiting the inhibitory signals that suppress T cell activation.
EXOSC3 antibody
EXOSC3 antibody was raised using the C terminal of EXOSC3 corresponding to a region with amino acids PLEIVFGMNGRIWVKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAES
PDGFRB antibody
PDGFRB antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purity:Min. 95%CMTM6 antibody
The CMTM6 antibody is a hormone peptide that binds to specific proteins in the body. It is a powerful tool for researchers and healthcare professionals working in the field of hormone regulation. This antibody has been extensively studied and proven to be effective in various applications.
COX2 antibody
The COX2 antibody is a powerful tool used in immunoassay tests to detect the presence of cyclooxygenase-2 (COX-2) protein. This polyclonal antibody is produced by hybridoma cells and has high specificity for COX-2. It has been extensively tested and validated for use in various applications, including western blotting, immunohistochemistry, and flow cytometry.
Adiponectin antibody
The Adiponectin antibody is a monoclonal antibody that specifically targets and inhibits the formation of adiponectin, a protein found in human serum. Adiponectin plays a crucial role in regulating insulin sensitivity and lipid metabolism, making it an important target for research in the field of Life Sciences. This antibody effectively blocks the interaction between adiponectin and its receptors, preventing downstream signaling pathways involved in hepatic steatosis and interferon production. By inhibiting the formation of TGF-β1, the Adiponectin antibody also has potential therapeutic applications in conditions such as ischemia-reperfusion injury. The high specificity and affinity of this monoclonal antibody ensure reliable results in antigen-antibody reactions. It can be used in various techniques, including particle reactions and cellulose-based assays. Researchers can rely on its performance to accurately detect and quantify adiponectin levels in different biological samples. Overall, the Adiponectin antibody
KRT8 antibody
The KRT8 antibody is a monoclonal antibody that specifically targets Keratin 8 (KRT8), a protein found in epithelial tissues. This antibody has been extensively studied and has shown promising results in various fields of research, particularly in the life sciences.
CD45RO antibody
The CD45RO antibody is a monoclonal antibody that specifically targets the CD45RO protein, which is expressed on activated T cells and memory T cells. This antibody has been extensively studied in the field of Life Sciences and has shown inhibitory effects on interleukin-6 (IL-6) signaling pathway and p38 MAPK activation. It has also been shown to inhibit syncytia formation, a process involved in viral infection.
MYST1 antibody
MYST1 antibody was raised in Mouse using a purified recombinant fragment of human MYST1 expressed in E. coli as the immunogen.
beta Amyloid antibody
The beta Amyloid antibody is a polyclonal antibody used in life sciences research. It specifically targets the beta amyloid protein, which plays a crucial role in the development of Alzheimer's disease. This antibody can be used for various applications such as immunohistochemistry and nuclear staining. By binding to the beta amyloid protein, this antibody helps researchers study its distribution and localization within cells and tissues. Additionally, it can be used as a potential medicament for targeting beta amyloid in therapeutic interventions. The beta Amyloid antibody is highly specific and exhibits strong affinity towards its target, making it an essential tool for studying the pathogenesis of Alzheimer's disease and developing novel treatment strategies.
SLC22A17 antibody
The SLC22A17 antibody is a powerful tool used in Life Sciences research for the detection and analysis of cxcl13, a nuclear antigen. This polyclonal antibody has been extensively tested and validated for various applications, including immunohistochemistry and DNA-binding protein studies. It specifically recognizes and binds to the surface glycoprotein expressed by SLC22A17, forming a specific complex that can be visualized using techniques such as impedance spectroscopy. With its high specificity and sensitivity, this monoclonal antibody is an essential component in any research project requiring the detection of SLC22A17. Trust in its reliability and accuracy to advance your scientific endeavors.
IL2 antibody
IL2 antibody was raised in rabbit using highly pure recombinant human IL-2 as the immunogen.Purity:Min. 95%Lamin B2 antibody
The Lamin B2 antibody is a highly specialized antibody that targets autoantibodies in cardiomyocytes. It is also effective against anti-mesothelin antibodies. This antibody plays a crucial role in the field of Life Sciences and medicine, as it serves as a serum marker for various diseases and conditions. The Lamin B2 antibody has been shown to interact with dopamine, which is involved in numerous physiological processes. Additionally, this antibody has the ability to activate methyltransferase enzymes and modulate interleukin levels. Furthermore, it influences the release of acetylcholine and regulates transmembrane conductance. With its unique properties and high specificity, the Lamin B2 antibody is an essential tool for researchers and healthcare professionals alike.
GFPT2 antibody
GFPT2 antibody was raised in rabbit using the N terminal of GFPT2 as the immunogen
Purity:Min. 95%KIFAP3 antibody
KIFAP3 antibody was raised using the middle region of KIFAP3 corresponding to a region with amino acids WLEMVESRQMDESEQYLYGDDRIEPYIHEGDILERPDLFYNSDGLIASEG
HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productCA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
