Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
MMP1 antibody
MMP1 antibody was raised in mouse using a synthetic peptide (VQGQNVLHGYPKDIYSSFG) corresponding to amino acid residues 332-350 0f human MMP-1 as the immunogen.
Parainfluenza type 3 antibody (FITC)
Parainfluenza type 3 antibody (FITC) was raised in mouse using hemagluttinin of parainfluenza virus, type 3 as the immunogen.KCTD13 antibody
KCTD13 antibody was raised using the N terminal of KCTD13 corresponding to a region with amino acids PGPAAYGLKPLTPNSKYVKLNVGGSLHYTTLRTLTGQDTMLKAMFSGRVE
CD19 antibody (PE-CY7)
CD19 antibody (PE-CY5.5) was raised in mouse using human CD19 as the immunogen.
Purity:Min. 95%Molecular weight:0 g/molMAP2 antibody
The MAP2 antibody is a highly specialized antibody used in Life Sciences research. It plays a crucial role in neutralizing the effects of glutamate, a growth factor involved in various cellular processes. This monoclonal antibody specifically targets endothelial growth and has been shown to inhibit the proliferation and migration of endothelial cells. Additionally, it has been found to bind to alpha-synuclein, a protein associated with neurodegenerative diseases like Parkinson's. The MAP2 antibody is available as both monoclonal and polyclonal antibodies, providing researchers with options for their specific needs. Its application extends beyond basic research, as it can be used in studies involving mesenchymal stem cells and microvessel density analysis. With its high specificity and sensitivity, the MAP2 antibody is an invaluable tool for scientists aiming to understand complex biological processes at the molecular level.
TNFSF10 antibody
TNFSF10 antibody was raised in rabbit using the N terminal of TNFSF10 as the immunogen
DPYS antibody
DPYS antibody was raised using the N terminal of DPYS corresponding to a region with amino acids VLDAAGKLVLPGGIDTHTHMQFPFMGSRSIDDFHQGTKAALSGGTTMIID
THBS2 antibody
The THBS2 antibody is a powerful tool in the field of Life Sciences. This antibody specifically targets and binds to CD33, a receptor protein involved in various biological processes. It can be used for research purposes, such as studying receptor binding and identifying binding proteins. Additionally, the THBS2 antibody has applications in diagnostics and therapeutics.
Goat anti human IgG
Goat anti human IgG is a highly effective inhibitor that targets antibodies, specifically sorafenib, in human serum. It has been extensively studied and proven to be effective in various applications, including electrochemical impedance in Life Sciences and immunoassays. This inhibitor works by blocking the activity of phosphatase, preventing the dephosphorylation of target proteins. Additionally, it can be used as a solubilizing agent for monoclonal antibodies, ensuring their stability and functionality. Goat anti human IgG is commonly used in research laboratories and pharmaceutical industries due to its high specificity and reliability. With its ability to bind to glycoproteins and induce fas-mediated apoptosis, this product offers a wide range of possibilities for experimental studies and therapeutic applications.
Factor VII antibody (FITC)
Factor VII antibody (FITC) was raised in sheep using human Factor VII purified from plasma as the immunogen.TIMP1 antibody
The TIMP1 antibody is a highly specific and sensitive tool used in Life Sciences research. It is an antibody that specifically targets and binds to TIMP1, which stands for Tissue Inhibitor of Metalloproteinase 1. TIMP1 is a protein that plays a crucial role in regulating the activity of enzymes known as metalloproteinases, which are involved in various biological processes including tissue remodeling, angiogenesis, and cell migration.
SGLT1 antibody
SGLT1 antibody was raised in rabbit using a 19 amino acid peptide sequence of mouse/rabbit SGLT-1 as the immunogen.Purity:Min. 95%PCBP3 antibody
PCBP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids QTPFPPLGQTNPAFPGEKLPLHSSEEAQNLMGQSSGLDASPPASTHELTI
Tau antibody
The Tau antibody is a powerful tool in Life Sciences research. It is an antibody that specifically targets and binds to the protein Tau, which plays a crucial role in neurodegenerative diseases such as Alzheimer's disease. The antibody has been extensively studied and validated for its specificity and sensitivity.Purity:Min. 95%HAVCR1 antibody
HAVCR1 antibody was raised using the N terminal of HAVCR1 corresponding to a region with amino acids CHYSGAVTSMCWNRGSCSLFTCQNGIVWTNGTHVTYRKDTRYKLLGDLSRPurity:Min. 95%MVD antibody
The MVD antibody is a highly specialized monoclonal antibody that targets the protein MVD (mevalonate diphosphate decarboxylase). This antibody is commonly used in Life Sciences research to study the function and regulation of MVD in various biological processes. It has been shown to interact with interleukin-6, chemokines, and nuclear proteins, indicating its involvement in immune responses and cellular signaling pathways.
DONSON antibody
DONSON antibody was raised using the middle region of DONSON corresponding to a region with amino acids DLITALISPTTRGLREAMRNEGIEFSLPLIKESGHKKETASGTSLGYGEE
TKTL1 antibody
TKTL1 antibody was raised using the middle region of TKTL1 corresponding to a region with amino acids QIQTSRNLDPQPPIEDSPEVNITDVRMTSPPDYRVGDKIATRKACGLALA
ADARB1 antibody
ADARB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QLSNGGGGGPGRKRPLEEGSNGHSKYRLKKRRKTPGPVLPKNALMQLNEI
PUS10 antibody
PUS10 antibody was raised using the middle region of PUS10 corresponding to a region with amino acids AVFVAGRYNKYSRNLPQTPWIIDGERKLESSVEELISDHLLAVFKAESFN
Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productCA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
