Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
Goat anti Mouse IgG (H + L) (biotin)
This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.
Purity:Min. 95%Heparin antibody
Heparin antibody is a monoclonal antibody that is used to detect and diagnose heparin-induced thrombocytopenia (HIT), a condition in which the body's immune system produces antibodies against heparin, a commonly used blood thinner. This antibody specifically targets the complex formed between heparin and platelet factor 4 (PF4), which is responsible for the immune response leading to HIT. Heparin antibody can also be used in research settings to study the interactions between heparin and other molecules, such as insulin. Additionally, this antibody has been used in the development of therapeutic monoclonal antibodies, such as trastuzumab, which is used to treat certain types of cancer. Its high specificity and sensitivity make it a valuable tool in various applications within the field of life sciences.
KIF5B antibody
KIF5B antibody was raised using the C terminal of KIF5B corresponding to a region with amino acids ANEVKQAVEQQIQSHRETHQKQISSLRDEVEAKAKLITDLQDQNQKMMLE
Purity:Min. 95%Donkey anti Sheep IgG (H + L) (HRP)
This antibody reacts with heavy (gamma) chains on sheep IgG and light chains on all sheep immunoglobulins.Purity:Min. 95%MCL1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug has been extensively studied using advanced techniques such as transcription-quantitative polymerase chain and patch-clamp technique, which have shown its efficacy in inhibiting bacterial growth. Additionally, it undergoes various metabolic transformations including hydrolysis by esterases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Its ability to bind to markers expressed in Mycobacterium tuberculosis strains further enhances its effectiveness in inhibiting cell growth.
Rabbit anti Goat IgG (H + L) (FITC)
Rabbit anti-goat IgG (H+L) (FITC) was raised in rabbit using goat IgG whole molecule as the immunogen.Purity:Min. 95%AFP antibody
The AFP antibody is a highly specialized monoclonal antibody that has been developed for various applications in the field of biomedical research. This antibody specifically targets and binds to alpha-fetoprotein (AFP), a human protein that is commonly found in the serum of individuals with certain medical conditions.
FSH antibody
The FSH antibody is a highly specialized immunohistochemistry tool used in the field of Life Sciences. It specifically targets the tumor necrosis factor-alpha (TNF-α) and acts as a kinase receptor growth factor. This polyclonal antibody plays a crucial role in binding proteins and cytotoxicity, particularly against tyrosine kinase receptors.
Purity:Min. 95%MEF2C antibody
The MEF2C antibody is a cytotoxic monoclonal antibody that targets the MEF2C protein. It has been shown to have multidrug resistance and can inhibit the production of interleukin-6 and chemokines. This antibody specifically binds to the p38 mitogen-activated protein and glycoprotein receptors, leading to cell death in cancer cells. Additionally, it has been found to have an inhibitory effect on steroid and fibronectin synthesis, which are important for tumor growth and metastasis. The MEF2C antibody is widely used in life sciences research and shows promise as a potential therapeutic agent in cancer treatment, particularly in combination with other monoclonal antibodies like trastuzumab.SEMA3D antibody
SEMA3D antibody was raised using the middle region of SEMA3D corresponding to a region with amino acids LECIPKSQQATIKWYIQRSGDEHREELKPDERIIKTEYGLLIRSLQKKDS
Purity:Min. 95%Cip1 antibody
Cip1 antibody was raised in rabbit using residues 139-164 of the p21 protein as the immunogen.
Purity:Min. 95%Goat anti Human IgG + IgA + IgM (Alk Phos)
This antibody reacts with heavy chains on human IgA + IgG + IgM and light chains on all human immunoglobulins.
Purity:Min. 95%SLCO1B1 antibody
SLCO1B1 antibody was raised in rabbit using the middle region of SLCO1B1 as the immunogenPurity:Min. 95%Eotaxin 3 antibody (biotin)
Eotaxin 3 antibody (biotin) was raised in goat using highly pure recombinant human eotaxin-3 as the immunogen.
ADARB1 antibody
ADARB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QLSNGGGGGPGRKRPLEEGSNGHSKYRLKKRRKTPGPVLPKNALMQLNEI
AIMP2 antibody
AIMP2 antibody was raised in rabbit using the middle region of AIMP2 as the immunogen
Purity:Min. 95%IKB alpha antibody
The IKB alpha antibody is a highly specialized monoclonal antibody that targets and binds to the inhibitor of kappa B alpha (IKBα) protein. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications. It is widely used in research laboratories for the detection and analysis of IKBα in different biological samples.
Purity:Min. 95%NKAIN1 antibody
NKAIN1 antibody was raised using the middle region of NKAIN1 corresponding to a region with amino acids TPVLNSRLALEDHHVISVTGCLLDYPYIEALSSALQIFLALFGFVFACYVPurity:Min. 95%PTGS1 antibody
PTGS1 antibody was raised using the middle region of PTGS1 corresponding to a region with amino acids GFTKALGHGVDLGHIYGDNLERQYQLRLFKDGKLKYQVLDGEMYPPSVEE
Purity:Min. 95%Goat anti Human IgG (H + L) (biotin)
Goat anti-human IgG (H + L) (biotin) was raised in goat using hamster IgG (H & L) as the immunogen.
Purity:Min. 95%PDE3A antibody
PDE3A antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purity:Min. 95%HSF1 antibody
The HSF1 antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets and neutralizes arginase, an enzyme involved in various cellular processes. This antibody has been extensively studied and proven to be highly effective in blocking the activity of arginase, allowing researchers to investigate its role in different biological systems.
Purity:Min. 95%ITGB3 antibody
The ITGB3 antibody is a highly specialized product that is used in the field of Life Sciences. This antibody specifically targets and binds to the integrin beta-3 subunit (ITGB3), which plays a critical role in various cellular processes. The ITGB3 antibody has been extensively studied for its potential therapeutic applications.
Purity:Min. 95%DLG2 antibody
DLG2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MFFACYCALRTNVKKYRYQDEDAPHDHSLPRLTHEVRGPELVHVSEKNLSPurity:Min. 95%STAT1 antibody
The STAT1 antibody is a powerful tool used in Life Sciences research for studying cellular signaling pathways and immune responses. It specifically targets the signal transducer and activator of transcription 1 (STAT1) protein, which plays a crucial role in mediating the effects of interferons and other cytokines.
Goat anti Rat IgG (Fab'2) (rhodamine)
Goat anti-rat IgG (Fab'2) (Rhodamine) was raised in goat using rat IgG F(c) fragment as the immunogen.
Purity:Min. 95%SRY antibody
The SRY antibody is a highly specialized growth factor that has been extensively studied in the field of Life Sciences. It plays a crucial role in various biological processes, including cell proliferation, differentiation, and development. The SRY antibody has been shown to have a neutralizing effect on interferon-gamma (IFN-gamma), which is an important cytokine involved in immune responses.Claudin 11 antibody
Claudin 11 antibody was raised using a synthetic peptide corresponding to a region with amino acids VSFGYSLYAGWIGAVLCLVGGCVILCCAGDAQAFGENRFYYTAGSSSPTH
Purity:Min. 95%CD19 antibody (Spectral Red)
CD19 antibody (Spectral Red) was raised in mouse using CD19+ murine pre-B cell line as the immunogen.
Purity:Min. 95%Molecular weight:0 g/mol
