Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
CD24 antibody (Azide Free)
CD24 antibody (Azide Free) was raised in rat using murine heat stable antigen as the immunogen.
Goat anti Human Lambda Chain (Fab'2)
Goat anti-human lambda chain (Fab'2) was raised in goat using human l (lambda) light chain as the immunogen.
Purity:Min. 95%CD8 antibody (Spectral Red)
CD8 antibody (Spectral Red) was raised in mouse using human CD8 as the immunogen.
hCG beta antibody
hCG beta antibody is a glycosylated monoclonal antibody that acts as a growth factor inhibitor. It has the ability to neutralize the activity of hCG beta, which is involved in various biological processes such as pregnancy and tumor growth. This antibody specifically targets the influenza hemagglutinin and inhibits its function, thereby preventing viral entry into host cells. Additionally, hCG beta antibody has been shown to inhibit protein kinase activity and interfere with interferon signaling pathways. It also exhibits necrosis factor-related apoptosis-inducing properties, promoting cell death in activated cells. With its unique characteristics and mechanisms of action, hCG beta antibody is a valuable tool for research and therapeutic applications.
Purity:Min. 95%GJC3 antibody
GJC3 antibody was raised in rabbit using the middle region of GJC3 as the immunogen
Purity:Min. 95%NPDC1 antibody
NPDC1 antibody was raised using the N terminal of NPDC1 corresponding to a region with amino acids MATPLPPPSPRHLRLLRLLLSGLVLGAALRGAAAGHPDVAACPGSLDCAL
GRK6 antibody
The GRK6 antibody is a highly specialized product used in the field of Life Sciences. It is an essential tool for researchers studying 3-kinase signaling pathways and related processes. This polyclonal antibody specifically targets and binds to GRK6, a key enzyme involved in signal transduction.
MEPE antibody
MEPE antibody was raised in rabbit using the middle region of MEPE as the immunogen
Purity:Min. 95%ICK antibody
The ICK antibody is a highly specialized antibody that targets the tyrosine kinase receptor, which plays a crucial role in growth factor signaling. This antibody is designed to specifically bind to the receptor and inhibit its activity, thereby blocking the downstream signaling pathways involved in cell growth and proliferation.
PNMT antibody
The PNMT antibody is a powerful tool used in Life Sciences research. It is a monoclonal antibody that specifically targets the enzyme phenylethanolamine N-methyltransferase (PNMT). This enzyme plays a crucial role in the synthesis of the neurotransmitter norepinephrine.
Cystatin C antibody
Cystatin C antibody is a highly specialized product used in the field of Life Sciences. It is a microparticle that forms an acid complex with cystatin C, a protein found in the body. This antibody is designed to specifically target and bind to cystatin C, allowing for its detection and measurement in various research applications.VANGL1 antibody
The VANGL1 antibody is a highly specialized monoclonal antibody that targets the VANGL1 protein. This protein is primarily found in the apical membrane of cells and plays a crucial role in various biological processes. The VANGL1 antibody has been extensively studied in the field of Life Sciences and has shown promising results in research related to epidermal growth factor signaling, tyrosine phosphorylation, human folate transport, collagen synthesis, and anti-CD20 therapy.
Calpain 2 antibody
Calpain 2 antibody was raised in mouse using purified bovine skeletal muscle 80 kDa subunit of m-calpain as the immunogen.
CTGF antibody
CTGF antibody was raised in rabbit using highly pure recombinant human CTGF as the immunogen.
Purity:Min. 95%QTRT1 antibody
QTRT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KDKPRYLMGVGYATDLVVCVALGCDMFDCVFPTRTARFGSALVPTGNLQL
WWP1 antibody
WWP1 antibody was raised using the N terminal of WWP1 corresponding to a region with amino acids ATASPRSDTSNNHSGRLQLQVTVSSAKLKRKKNWFGTAIYTEVVVDGEIT
Purity:Min. 95%AIFM3 antibody
AIFM3 antibody was raised using the middle region of AIFM3 corresponding to a region with amino acids EGFSDRIVLCTLDRHLPYDRPKLSKSLDTQPEQLALRPKEFFRAYGIEVL
Sumo1 antibody
The Sumo1 antibody is a polyclonal antibody that is used for the immobilization of human serum on an electrode. It is commonly used in research and laboratory settings to study the binding proteins and inhibitors involved in various cellular processes. This antibody has also been shown to have neutralizing effects on interferon, making it a valuable tool in immunology research. Additionally, the Sumo1 antibody has demonstrated neuroprotective properties and has been investigated for its potential use in treating neurodegenerative disorders. However, it is important to note that this antibody may have teratogenic effects and should be handled with caution. In the field of Life Sciences, the Sumo1 antibody plays a crucial role in understanding cellular pathways and protein interactions.
GABABR2 antibody
GABABR2 antibody was raised in rabbit using residues 42-54 [TRGAPRPPPSSPP] of the 105 kDa GABABR2 protein as the immunogen.
Purity:Min. 95%HES1 antibody
The HES1 antibody is a potent medicament that belongs to the class of antibodies. It specifically targets and neutralizes the activity of interferon-gamma (IFN-gamma), a growth factor involved in various cellular processes. This monoclonal antibody has been shown to inhibit the expression and function of urokinase plasminogen activator (uPA), which is responsible for thrombocytopenia and other clotting disorders. Additionally, the HES1 antibody has cytotoxic effects on cells expressing alpha-fetoprotein, a marker commonly found in certain types of cancer. Through its binding to the plasminogen activator receptor, this antibody disrupts signal transduction pathways involving tyrosine kinases, leading to impaired cell proliferation and survival. The HES1 antibody is widely used in Life Sciences research for its ability to modulate immune responses and investigate IFN-gamma-related diseases.
Moesin antibody
Moesin antibody is an endogenous hematopoietic monoclonal antibody that has anticoagulant properties. It binds to fatty acids and other molecules, inhibiting their activity in the blood. This antibody has been shown to have anti-VEGF (vascular endothelial growth factor) activity, which can help prevent the formation of new blood vessels and inhibit tumor growth. Moesin antibody is activated at acidic pH levels and can effectively neutralize insulin antibodies in human serum. Additionally, this antibody has been used as a growth factor in cell culture experiments due to its ability to promote cell proliferation and survival.ZKSCAN1 antibody
ZKSCAN1 antibody was raised in rabbit using the N terminal of ZKSCAN1 as the immunogen
Purity:Min. 95%HIV1 antibody (HTLV3)
HIV1 antibody (HTLV3) was raised in goat using human isolate as the immunogen.Purity:Min. 95%Fos antibody
The Fos antibody is a highly specialized monoclonal antibody that is used in Life Sciences research. It specifically targets the nuclear protein Fos, which plays a crucial role in cellular processes such as glucose transporter regulation and growth factor signaling. This antibody is commonly used to study thrombotic microangiopathy, a condition characterized by abnormal clot formation in small blood vessels. By binding to Fos, the antibody allows researchers to visualize and analyze the activation of this important protein. In addition to its use in research, there are also polyclonal antibodies available for detecting other components of the actin filaments, such as phalloidin or actin itself. These antibodies are valuable tools for studying atypical hemolytic disorders and other conditions involving actin dynamics. With their high specificity and sensitivity, these antibodies provide researchers with reliable results for their experiments.
Donkey anti-Mouse IgG (H+L) biotin
Donkey ant-mouse IgG (H + L) secondary antibody biotinPurity:Min. 95%Rat Thrombocyte antibody
Rat thrombocyte antibody was raised in rabbit using rat thrombocytes as the immunogen.
Purity:Min. 95%PKNOX1 antibody
The PKNOX1 antibody is a highly specialized monoclonal antibody that targets the PKNOX1 protein. This protein is involved in various cellular processes, including fibrinogen production, cell antigen presentation, and amyloid plaque formation. Additionally, PKNOX1 plays a crucial role as a growth factor and phosphatase regulator.
ADA antibody
ADA antibody was raised using the middle region of ADA corresponding to a region with amino acids ANYSLNTDDPLIFKSTLDTDYQMTKRDMGFTEEEFKRLNINAAKSSFLPEPurity:Min. 95%
