Primary Antibodies

<p>MPP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QGVGRRSLKNKLIMWDPDRYGTTVPYTSRRPKDSEREGQGYSFVSRGEME</p>

<p>The SSH3 antibody is a highly specialized product in the field of Life Sciences. It is an amino-terminal activated antibody that is commonly used in research and diagnostic applications. This antibody specifically targets and binds to various proteins, such as annexin, chemokine, glucagon, and natriuretic peptides. The SSH3 antibody has been extensively tested and validated for its high specificity and sensitivity.</p>

<p>Mouse monoclonal CD45.1 antibody (allophycocyanin)</p>

<p>Rabbit polyclonal SLC26A3 antibody</p>

<p>ITGA9 antibody was raised in Rabbit using Human ITGA9 as the immunogen</p>

<p>Mouse monoclonal OB Cadherin antibody</p>

<p>The SEMA3C antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It has been extensively studied for its ability to inhibit the activity of interleukin-6 (IL-6), a multifunctional cytokine involved in various biological processes. This antibody has also shown promising results in inhibiting multidrug resistance and TGF-beta signaling.</p>

<p>The EpCAM antibody is a monoclonal antibody that specifically targets the Epithelial Cell Adhesion Molecule (EpCAM). It has been widely used in various applications within the field of Life Sciences. The EpCAM antibody has proven to be highly effective in detecting and quantifying alpha-fetoprotein (AFP), a protein commonly associated with liver cancer, as well as in studying breast cancer cells such as MCF-7.</p>

Rabbit polyclonal SLC25A20 antibody

<p>Rabbit polyclonal RHOQ antibody</p>

<p>LPCAT2 antibody was raised in Rabbit using Human LPCAT2 as the immunogen</p>

STC1 antibody is a polyclonal antibody that specifically targets the epidermal growth factor STC1. It is widely used in life sciences research and has been shown to have neutralizing effects on STC1 activity. This antibody can be used in various applications, such as Western blotting, immunohistochemistry, and enzyme-linked immunosorbent assay (ELISA). The STC1 antibody binds to the target protein and blocks its interaction with receptors, inhibiting downstream signaling pathways involved in cell growth and differentiation. It is an essential tool for studying the role of STC1 in various biological processes and for developing potential therapeutic inhibitors or modulators of this important growth factor.

<p>The PTP1B antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that targets and inhibits the activity of protein tyrosine phosphatase 1B (PTP1B). This enzyme plays a crucial role in various cellular processes, including fas-mediated apoptosis, epidermal growth factor signaling, and regulation of insulin and leptin receptors.</p>

<p>ZAP70 antibody is a highly specialized product used in immunoassays and research within the field of Life Sciences. It is a polyclonal antibody that specifically targets ZAP70, a protein involved in T-cell signaling pathways. This antibody can be used to detect and measure the levels of ZAP70 in various biological samples, such as human serum or tissue lysates. It can also be used as a neutralizing agent to inhibit the activity of ZAP70 in experimental settings. The ZAP70 antibody is produced using advanced techniques, including monoclonal antibody production and purification processes. It has been extensively tested for specificity and sensitivity, ensuring accurate and reliable results. Researchers rely on this high-quality antibody to study the role of ZAP70 in immune responses, steroid signaling, fatty acid metabolism, interferon activation, and other important cellular processes. With its wide range of applications and exceptional performance, the ZAP70 antibody is an indispensable tool for scientists working in immunology and related fields.</p>

<p>PDK3 antibody was raised using the N terminal of PDK3 corresponding to a region with amino acids RPSVGLVQSWYMQSFLELLEYENKSPEDPQVLDNFLQVLIKVRNRHNDVV</p>

The ABCC3 antibody is a highly effective anti-VEGF (vascular endothelial growth factor) agent. It belongs to the class of agonist proteins and is specifically designed for use in Life Sciences research. This polyclonal antibody has been engineered to bind to VEGF, a key growth factor involved in angiogenesis, and inhibit its activity. The ABCC3 antibody has also shown binding affinity towards other growth factors such as erythropoietin, making it a versatile tool for studying various cellular processes. In addition to its antiangiogenic properties, this antibody has demonstrated cytotoxic effects on target cells, making it a valuable tool for cancer research. Its unique beta-hairpin structure ensures optimal binding efficiency and specificity. Researchers can use the ABCC3 antibody in various applications including immunohistochemistry, Western blotting, and flow cytometry experiments. With its high-quality formulation and reliable results, this antibody is an essential component of any research project focused on understanding vascular development and angi

<p>Rabbit polyclonal Stefin A antibody</p>

<p>DHX37 antibody was raised using a synthetic peptide corresponding to a region with amino acids PLTKKEKKVLQKILEQKEKKSQRAEMLQKLSEVQASEAEMRLFYTTSKLG</p>

Salmonella antibody was raised in mouse using LPS of Salmonella typhimurium as the immunogen.

<p>ERCC5 antibody was raised using the N terminal of ERCC5 corresponding to a region with amino acids NPQAIDIESEDFSSLPPEVKHEILTDMKEFTKRRRTLFEAMPEESDDFSQ</p>

<p>Rabbit polyclonal ARPP21 antibody</p>

Mouse monoclonal ASF1B antibody

<p>Rabbit polyclonal IFIT1 antibody</p>

The MMP3 antibody is a monoclonal antibody that specifically targets and binds to matrix metalloproteinase 3 (MMP3). MMP3 is an enzyme involved in the breakdown of collagen, which plays a crucial role in various physiological processes. This antibody has antiviral properties and can be used in research and diagnostic applications in Life Sciences.

<p>FKBPL antibody was raised using the N terminal of FKBPL corresponding to a region with amino acids METPPVNTIGEKDTSQPQQEWEKNLRENLDSVIQIRQQPRDPPTETLELE</p>

Rat monoclonal CD45RB antibody (PE)

Influenza B antibody was raised in mouse using Influenza B as the immunogen.

Rabbit polyclonal 14-3-3 beta zeta antibody (Ser184/186)

<p>UNG antibody was raised in mouse using recombinant human UNG (1-313aa) purified from E. coli as the immunogen.</p>

<p>EIF3E antibody was raised using the middle region of EIF3E corresponding to a region with amino acids LNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTK</p>

The DCX antibody is a polyclonal antibody that specifically targets the Doublecortin (DCX) protein. This protein plays a crucial role in neuronal migration and differentiation during brain development. The DCX antibody can be used for various applications, including immunohistochemistry, western blotting, and ELISA.

Armenian Hamster monoclonal FceRI alpha antibody (biotin)

<p>Rabbit polyclonal RPL34 antibody</p>

<p>KCTD15 antibody was raised in Rabbit using Human KCTD15 as the immunogen</p>

<p>BRaf antibody is a high-quality polyclonal antibody that is widely used in life sciences research. It specifically targets BRaf, a protein involved in various cellular processes such as collagen synthesis and regulation of alpha-fetoprotein expression. This antibody is highly specific and has low cross-reactivity with other proteins, ensuring accurate and reliable results.</p>

<p>Rabbit polyclonal TNS4 antibody</p>

<p>Rabbit polyclonal BRaf antibody (Thr598)</p>

Mouse monoclonal FBXO21 antibody

<p>Rabbit polyclonal OR2AE1 antibody</p>

Troponin T antibody is a highly specialized antibody that specifically targets and activates troponin T, a protein involved in muscle contraction. This monoclonal antibody has been extensively studied and proven to be effective in various applications. It has been used to investigate the role of troponin T in different physiological processes, including the response to epinephrine and adeno-associated viral infection. Additionally, this antibody has shown promising results in research related to collagen synthesis, microvessel density, glycoprotein analysis, and metal-binding protein studies. Its high specificity and affinity make it a valuable tool for researchers in the field of life sciences. With its ability to target troponin T with precision, this monoclonal antibody opens up new possibilities for understanding the intricate mechanisms of muscle function and related diseases.

<p>Rabbit polyclonal Raf1 antibody (Ser338)</p>

The TMED2 antibody is an essential tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to TMED2, a protein involved in various cellular processes. This antibody has been extensively studied and proven to be highly effective in neutralizing the activity of TMED2.

<p>The GR antibody is a highly specialized antibody that targets and interacts with specific molecules involved in various biological processes. It is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific needs.</p>

<p>The FXN antibody is a highly specialized product in the field of Life Sciences. It plays a crucial role in endothelial growth and is widely used in various research applications. This antibody specifically targets calmodulin, a protein involved in signal transduction and cell proliferation.</p>

<p>HIST2H2AA3 antibody was raised using the middle region of HIST2H2AA3 corresponding to a region with amino acids PRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK</p>

<p>Rabbit polyclonal WDR24 antibody</p>

<p>Purified Rabbit polyclonal FUBP3 antibody</p>

<p>Mouse monoclonal BUB1B antibody</p>

<p>The EGFR antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to the epidermal growth factor receptor (EGFR). This receptor plays a crucial role in cell signaling and has been implicated in various diseases, including cancer.</p>

<p>FAM83B antibody was raised using the C terminal of FAM83B corresponding to a region with amino acids PRRKHSSSSNSQGSIHKSKEDVTVSPSQEINAPPDENKRTPSPGPVESKF</p>

<p>The PARK7 antibody is a highly specialized monoclonal antibody that targets and inhibits the activity of phosphatase enzymes. This antibody has been extensively studied for its potential therapeutic applications in various fields, including insulin signaling, collagen synthesis, chemokine regulation, nuclear processes, and growth factor signaling.</p>

<p>Mouse monoclonal SDR9C7 antibody</p>

<p>The SMS antibody is a powerful tool in the field of Life Sciences. It is an anti-HER2 antibody that specifically targets and binds to HER2 receptors, which are overexpressed in certain types of cancer cells. This antibody can be used for various applications, such as immunofluorescence (IF) staining or Western blotting, to detect the presence of HER2 proteins in samples.</p>

<p>The TIMM17B antibody is a highly specialized antibody that plays a crucial role in various biological processes. It acts as a calpastatin, inhibiting the activity of calpains and preventing their cytotoxic effects. This antibody can be used in research studies to investigate the role of calpain in cellular processes.</p>

<p>The Cytokeratin 7 antibody is a diagnostic reagent that consists of polyclonal and monoclonal antibodies. These antibodies are specifically designed to target and neutralize cytokeratin 7, a metal-binding protein involved in various cellular processes. The Cytokeratin 7 antibody can be used in diagnostic tests to detect the presence of cytokeratin 7 in biological samples, such as tissue or blood. This antibody can also be used to study the role of cytokeratin 7 in iron homeostasis, as it has been shown to interact with spleen ferritin and regulate iron levels. Additionally, the Cytokeratin 7 antibody has been found to be activated by interferon, suggesting its potential as an antiviral agent.</p>

<p>Rat monoclonal TRAIL antibody (biotin)</p>

Rabbit polyclonal Tau antibody (Ser262)

<p>IDI1 antibody was raised in Rabbit using Human IDI1 as the immunogen</p>

<p>The HSPA8 antibody is a glycoprotein that plays a crucial role in various cellular processes. It acts as a chaperone protein, assisting in the folding and unfolding of other proteins. This antibody also interacts with mitogen-activated protein (MAP) kinases, specifically p38 MAPK, which is involved in cell signaling pathways. By modulating p38 MAPK activity, the HSPA8 antibody can influence cellular responses such as proliferation, differentiation, and apoptosis.</p>

<p>Purified Rabbit polyclonal CKLF6 antibody</p>

<p>Mouse monoclonal FBXO21 antibody</p>

Rabbit polyclonal KIAA0562 antibody

The HSPBP1 antibody is a reactive antibody that targets the growth factor known as anti-glial fibrillary acidic protein (GFAP). It is commonly used in Life Sciences research and can be utilized for various applications. This monoclonal antibody specifically binds to GFAP, which is an intermediate filament protein found in astrocytes and other glial cells. The antibody can be used to detect and quantify GFAP levels in samples such as human serum or tissue sections. Additionally, it has been shown to have neuroprotective effects and can inhibit the activity of pancreatic elastase. The HSPBP1 antibody is a valuable tool for researchers studying glial cells and their involvement in various physiological processes.

Rat monoclonal CD41 antibody (PE)

Rabbit polyclonal ZMYND10 antibody

<p>The Cytokeratin 10 antibody is a glycoprotein that is widely used in the field of Life Sciences. It is a monoclonal antibody specifically designed to target and bind to Cytokeratin 10, which is an important protein marker in various biological processes. This antibody has been extensively studied and shown to have high specificity and sensitivity in detecting Cytokeratin 10.</p>

Mouse monoclonal COX6A1 antibody

DDX27 antibody was raised in mouse using recombinant Human Dead (Asp-Glu-Ala-Asp) Box Polypeptide 27 (Ddx27)

ABCF1 antibody was raised in mouse using recombinant Transcription Factor Ap-2 Gamma (Activating Enhancer Binding Protein 2 Gamma) (Tfap2C)

<p>The CIDEB antibody is a highly specialized reagent used in the field of Life Sciences. It is an affinity ligand that specifically binds to CIDEB protein, making it an essential tool for researchers studying hematopoietic cells and pluripotent stem cells. This polyclonal antibody can be used in various applications, including immunohistochemical analysis, protein detection, and inhibition studies.</p>

<p>Rabbit polyclonal PLC beta antibody</p>

<p>GMPS antibody was raised using the middle region of GMPS corresponding to a region with amino acids VCTALLNRALNQEQVIAVHIDNGFMRKRESQSVEEALKKLGIQVKVINAA</p>

The HSP60 antibody is a neuroprotective agent that belongs to the family of endothelial growth factors. It acts as a neurotrophic factor, promoting the growth and survival of neurons. This antibody is colloidal in nature and is widely used in Life Sciences research. It is a monoclonal antibody specifically designed to target and neutralize endothelial growth factor, which plays a crucial role in angiogenesis and vascular development. The HSP60 antibody can also be used to detect the presence of specific antigens, such as circumsporozoite protein, in biological samples. With its high specificity and sensitivity, this antibody is an essential tool for researchers studying various aspects of cell biology and immunology.

<p>The SPARC antibody is a monoclonal antibody that is used in Life Sciences research. It specifically targets the SPARC protein, which plays a crucial role in various biological processes. The antibody binds to SPARC and inhibits its activity, making it a valuable tool for studying the function of this protein.</p>

Mouse monoclonal GRHPR antibody

<p>Beta Lactamase antibody was raised using the C terminal of LACTB corresponding to a region with amino acids TEMSWDKEGKYAMAWGVVERKQTYGSCRKQRHYASHTGGAVGASSVLLVL</p>

<p>HAX1 antibody was raised in Rabbit using Human HAX1 as the immunogen</p>

The JAK1 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It targets specific proteins, such as telomerase, cxcr4, and chemokine receptors, to inhibit their activity. This antibody has been shown to induce necrosis factor-related apoptosis-inducing cell death in various cell types, making it a valuable tool for cytotoxic studies. Additionally, the JAK1 antibody can be used to detect and quantify autoantibodies in patient samples, aiding in the diagnosis of autoimmune diseases. It has also been found to have potential therapeutic applications for conditions such as thrombocytopenia and nephrotoxicity. With its high specificity and efficacy, the JAK1 antibody is an essential tool for researchers studying growth factors and signaling pathways in various biological systems.

<p>PRPF8 antibody was raised using a synthetic peptide corresponding to a region with amino acids SHRHSVKSQEPLPDDDEEFELPEFVEPFLKDTPLYTDNTANGIALLWAPR</p>

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the class of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. This compound works by binding to DNA-dependent RNA polymerase, which inhibits bacterial growth and prevents transcription and replication. Its efficacy has been demonstrated through extensive testing using the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.

<p>Rat monoclonal CD9 antibody (FITC)</p>

<p>Rabbit polyclonal MYT1 antibody (Ser83)</p>

<p>Rabbit polyclonal TMED3 antibody</p>

<p>Rabbit polyclonal HSPB2 antibody</p>

<p>Rabbit polyclonal MAP2K7 antibody (Thr275)</p>

<p>Rabbit Polyclonal OR4C3 antibody</p>

<p>Rabbit polyclonal MED14 antibody</p>

<p>HGS antibody was raised in Rabbit using Human HGS as the immunogen</p>

<p>Rabbit polyclonal MAP1LC3A antibody</p>

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is specifically designed to combat tuberculosis infection by targeting active compounds and exerting bactericidal activity. This drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its effectiveness has been demonstrated through extensive research using advanced techniques like the patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, it exhibits high affinity for markers expressed in Mycobacterium tuberculosis strains and effectively inhibits their growth in culture.

<p>The CD40 antibody is a powerful tool used in the field of Life Sciences. It acts by binding to the CD40 protein, which plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to have numerous applications.</p>

<p>NUDT18 antibody was raised using a synthetic peptide corresponding to a region with amino acids MASEGLAGALASVLAGQGSSVHSCDSAPAGEPPAPVRLRKNVCYVVLAVF</p>

<p>Rabbit polyclonal ZNF699 antibody</p>

<p>GZMM antibody was raised in Rabbit using Human GZMM as the immunogen</p>

Mouse monoclonal Mature Macrophage Marker antibody

<p>GMFG antibody was raised in Rabbit using Human GMFG as the immunogen</p>

Adenovirus antibody was raised in mouse using hexon group antigen of numerous ADV as the immunogen.

<p>Purified Polyclonal Cytochrome P450 8B1 antibody</p>

<p>HECTD2 antibody was raised using the N terminal of HECTD2 corresponding to a region with amino acids MSEAVRVPSPATPLVVAAPAPEERKGKESEREKLPPIVSAGAGATAGLDR</p>

<p>Rabbit polyclonal PLEKHG6 antibody</p>