Primary Antibodies

Affinity purified Rabbit polyclonal HUS1 antibody

Rat monoclonal TRANCE antibody (PE)

The L1CAM antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets L1CAM, a glycoprotein involved in cell adhesion and migration. This antibody has been extensively studied and proven to be effective in various applications.

Affinity purified Rabbit polyclonal ZNF313 antibody

The SCG3 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the nuclear factor kappa-light-chain-enhancer of activated B cells (NF-κB), which is a transcription factor involved in various cellular processes. The SCG3 antibody has been shown to inhibit the polymerase activity of NF-κB, leading to a decrease in gene expression of acidic proteins. This antibody can be used in immunoassays to detect and quantify NF-κB activation. Additionally, the SCG3 antibody has proteolytic activity and has been shown to cleave caspase-9, an endonuclease involved in apoptosis. Its immobilization on surfaces allows for easy and efficient use in various experimental settings, making it a valuable tool for researchers studying NF-κB signaling pathways and related cellular processes.

CD107b antibody (FITC) was raised in rat using glycoproteins purified from BALB/c mouse embryo 3T3 cell line as the immunogen.

Rabbit polyclonal TNFSF10 antibody (HRP)

Affinity purified Goat polyclonal Eotaxin 3 antibody

Purified Polyclonal GNG8 antibody

The Human Nuclei antibody is a monoclonal antibody that specifically targets the nuclei of human cells. It recognizes sugar moieties on nuclear proteins and can be used for various applications in life sciences research. This antibody has been shown to be highly specific and sensitive, allowing for accurate detection of human nuclei in tissue samples.

FN3KRP antibody was raised using the N terminal of FN3KRP corresponding to a region with amino acids MDPGDPAGDPAAGERHRMGRDPLLLLQALQTLWSTRERKQLREEAWRGFA

Affinity purified Rabbit polyclonal PSME3 antibody

PCBP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids QTPFPPLGQTNPAFPGEKLPLHSSEEAQNLMGQSSGLDASPPASTHELTI

BIRC8 antibody was raised in Rabbit using Human BIRC8 as the immunogen

The Histamine H4 Receptor antibody is a powerful tool for researchers in the field of Life Sciences. It is available in both polyclonal and monoclonal forms, providing options for different experimental needs.

Mouse monoclonal HIV1 p55+17 antibody

Rabbit polyclonal PKC pan antibody

Mouse monoclonal ETF1 antibody

GFP antibody (HRP) was raised in goat using a GFP fusion protein corresponding to the full length amino acid sequence (246aa) derived from the jellyfish Aequorea victoria as the immunogen.

The PVRL2 antibody is a highly specialized antibody that targets the PVRL2 protein. This protein plays a crucial role in various biological processes, including cell adhesion, immune response, and signal transduction. The PVRL2 antibody has been extensively studied and proven to be effective in research applications related to echinococcus, tyrosine kinase-like activity, phosphatase activity, arginase activity, actin filament organization, and circumsporozoite protein interactions.

TSH beta antibody was raised against Human TSH (intact).

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth and prevents transcription and replication. This active compound has been extensively studied using a patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.

TKTL1 antibody was raised using the middle region of TKTL1 corresponding to a region with amino acids QIQTSRNLDPQPPIEDSPEVNITDVRMTSPPDYRVGDKIATRKACGLALA

MPP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RDVFSEKSLSYLMKIHEKLRYYERQSPTPVLHSAVALAEDVMEELQAASV

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections as it contains active compounds with bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, inhibiting bacterial growth and preventing transcription and replication. Its efficacy has been proven through extensive testing using the patch-clamp technique on human erythrocytes. The metabolization of this drug involves various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and effectively inhibits cell growth in culture.

PREP antibody was raised using the N terminal of PREP corresponding to a region with amino acids THDGKGMFYNSYPQQDGKSDGTETSTNLHQKLYYHVLGTDQSEDILCAEF

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a potent antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. This drug has been extensively studied using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. It undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, or conjugation. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth. Experience the powerful action of 6-Fluoro-3-indoxyl-beta-D-galactopyranoside for effective tuberculosis treatment.

CRY1 antibody was raised in Rabbit using Human CRY1 as the immunogen

Tropomyosin 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids AETRAEFAERSVAKLEKTIDDLEDEVYAQKMKYKAISEELDNALNDITSL

Rabbit polyclonal NFKB p105/p50 antibody (Ser927)

CERK antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, thereby inhibiting bacterial growth and preventing transcription and replication. In addition, it has been extensively studied using advanced techniques like patch-clamp technique on human erythrocytes. The metabolism of this drug involves various transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, it specifically targets markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture.

IFRD2 antibody was raised in Rabbit using Human IFRD2 as the immunogen

The PAR4 antibody is a potent antiviral agent that belongs to the class of antibodies. It is available in both polyclonal and monoclonal forms, with the monoclonal antibody being highly neutralizing. This antibody specifically targets the PAR4 receptor, which is involved in various cellular processes such as cyclase-activating and ketamine signaling. In the field of Life Sciences, this antibody is widely used for research purposes due to its high specificity and affinity for PAR4. It can be utilized for studying biomolecules like transferrin, low density lipoprotein (LDL), globulin, and erythropoietin. The PAR4 antibody is also commonly used in immunoassays and other analytical techniques to detect and quantify PAR4 levels. Its colloidal properties make it suitable for various applications in the biomedical field.

Affinity purified Rabbit polyclonal CSDE1 antibody

CD25 antibody is a drug that targets the IL-2 receptor, which is involved in immune system activation. It is an anti-CD25 antibody that has been developed as a potential treatment for various diseases, including cancer. CD25 antibody works by blocking the IL-2 receptor and preventing the binding of IL-2, a growth factor that stimulates the proliferation and activation of immune cells. This inhibition of IL-2 signaling can help regulate immune responses and potentially suppress autoimmune reactions. CD25 antibody is a monoclonal antibody, meaning it is produced from a single clone of cells and specifically targets the CD25 antigen on immune cells. It has shown promising results in preclinical studies and is being investigated as a potential therapeutic option in Life Sciences research. The use of CD25 antibody in combination with other drugs, such as histone deacetylase inhibitors or C-C chemokine receptor antagonists, may enhance its efficacy and provide additional benefits.

TADA1L antibody was raised using a synthetic peptide corresponding to a region with amino acids REVIPTHTVYALNIERIITKLWHPNHEELQQDKVHRQRLAAKEGLLLC

Affinity purified Rabbit polyclonal FBXL12 antibody

The ApoD antibody is a monoclonal antibody that specifically targets tumor necrosis factor-alpha (TNF-α). It is produced by hybridoma cells and has been widely used in the field of Life Sciences for research purposes. This monoclonal antibody has shown to effectively neutralize TNF-α, which plays a crucial role in inflammation and immune response. In addition to TNF-α, the ApoD antibody also targets other cytokines such as interleukin-6 (IL-6) and leukemia inhibitory factor (LIF). The binding of this antibody to its target molecules can modulate various cellular processes including transmembrane conductance, epidermal growth factor signaling, and oncogenic kinase activity. With its high specificity and affinity, the ApoD antibody is a valuable tool for researchers studying these pathways and exploring potential therapeutic applications. Additionally, polyclonal antibodies against ApoD are also available for researchers who require a broader range of epitope recognition.

MLF1 antibody was raised in Rabbit using Human MLF1 as the immunogen

Affinity purified Rabbit polyclonal BAIAP2L1 antibody

Mouse monoclonal CD3 antibody (PE)

Fibrinopeptide A antibody was raised in mouse using Fibrinopeptide A conjugated with carrier protein as the immunogen.

The POSTN antibody is an inhibitory factor that belongs to the group of polyclonal antibodies. It is specifically designed to target and neutralize the activity of POSTN, a protein expressed in cardiomyocytes. This antibody is widely used in life sciences research and has been shown to effectively inhibit the function of autoantibodies against POSTN. The POSTN antibody is available in both polyclonal and monoclonal forms, allowing researchers to choose the most suitable option for their experiments. Its high affinity and specificity make it an ideal tool for studying the role of POSTN in various biological processes, such as cell signaling, inflammation, and tissue remodeling. The amino-terminal region of the POSTN protein is particularly targeted by this antibody, ensuring accurate and reliable results. Order your POSTN antibody today and unlock new insights into its function and therapeutic potential.

AP3M2 antibody was raised using the middle region of AP3M2 corresponding to a region with amino acids VVNTITGSTNVGDQLPTGQLSVVPWRRTGVKYTNNEAYFDVIEEIDAIID

HSDL1 antibody was raised in Rabbit using Human HSDL1 as the immunogen

The alpha CGRP antibody is a highly effective monoclonal antibody that targets beta-calcitonin gene-related peptide (CGRP). It has been extensively studied for its efficacy and safety in toxicity studies. This antibody specifically binds to CGRP, preventing its interaction with receptors and inhibiting its biological activity. In addition to its therapeutic potential, the alpha CGRP antibody has shown promising results in the treatment of mucopolysaccharidosis type I. It has been demonstrated to enhance the clearance of accumulated glycosaminoglycans, leading to improved clinical outcomes in preclinical models. Moreover, this monoclonal antibody exhibits excellent stability and minimal immunogenicity when tested in human serum and recombinant virus systems. Its high affinity for CGRP allows for efficient receptor binding and endocytic uptake into target cells. Furthermore, the alpha CGRP antibody has been engineered with a low-molecular-weight chelator deferoxamine, which enhances its stability and prolongs its half-life.

The GST antibody is a highly effective inhibitor that belongs to the class of monoclonal antibodies. It is widely used in Life Sciences research for various applications. This antibody specifically targets and binds to glutathione S-transferase (GST), a glycoprotein commonly used as a fusion tag in protein purification and detection assays. The GST antibody can be immobilized on an electrode or streptavidin-coated surface for use in immunoassays, electrophoresis, or other experimental techniques. Additionally, this antibody has shown promising results in the treatment and/or prophylaxis of certain diseases, including its potential anti-angiogenesis effects. Its specificity and high affinity make it an invaluable tool for researchers studying GST-related processes or developing diagnostic tests using human serum samples.

The PCBP2 antibody is a highly potent and cytotoxic antibody that targets the topoisomerase IIalpha enzyme. It is a polyclonal antibody that has been extensively studied in Life Sciences research. This antibody has shown high affinity for its target and has been proven effective in detecting and quantifying topoisomerase IIalpha levels in human serum samples.

Rabbit polyclonal RPS21 antibody

MTLR antibody is a highly reactive drug antibody that is widely used in Life Sciences research. It specifically targets glutamate, a neurotransmitter involved in various physiological processes. This antibody is available in both polyclonal and monoclonal forms, offering researchers the flexibility to choose the best option for their experiments. MTLR antibody can be used in various applications such as immunohistochemistry, Western blotting, and ELISA assays. It has been shown to effectively detect and quantify glutamate levels in samples. Additionally, this antibody can also be used to study the role of glutamate receptors and their downstream signaling pathways, including insulin phosphatase 3-kinase and TGF-beta1. Its high specificity and affinity make it an essential tool for researchers working on understanding the molecular mechanisms underlying various diseases and disorders.

Mouse monoclonal CD1d antibody (PE)

Affinity purified Mouse polyclonal IKK alpha antibody

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infection due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thus preventing bacterial growth. The efficacy of this drug has been demonstrated through patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.

WDR77 antibody was raised using the N terminal of WDR77 corresponding to a region with amino acids MRKETPPPLVPPAAREWNLPPNAPACMERQLEAARYRSDGALLLGASSLS

Mouse monoclonal GSTO2 antibody

NDUFA9 antibody was raised in Rabbit using Human NDUFA9 as the immunogen

Affinity purified Rabbit polyclonal GLYATL1 antibody

Affinity purified Rabbit polyclonal C1orf165 antibody

POLG2 antibody was raised in rabbit using the N terminal of POLG2 as the immunogen

The Tau antibody is a medicament that belongs to the class of globulin-based drugs. It is a polyclonal antibody that has been specifically designed to target and neutralize the activity of Tau protein. Tau protein plays a crucial role in the pathogenesis of neurodegenerative diseases, such as Alzheimer's disease, by forming abnormal aggregates in the brain.

The Caspase 2 antibody is a cytotoxic monoclonal antibody that targets the Caspase 2 protein. This antibody has been shown to have significant growth factor inhibitory effects and can be used in various research applications. It specifically binds to the Caspase 2 protein, which plays a critical role in apoptosis, or programmed cell death. The antibody can be used for immunohistochemistry, immunofluorescence, and Western blotting experiments to study the expression and localization of Caspase 2 in different tissues and cell types. Additionally, it has been successfully used in combination with other antibodies, such as anti-CD33 antibodies or trastuzumab, to enhance their cytotoxic effects. This highly specific antibody recognizes both native and denatured forms of the Caspase 2 protein and is suitable for use with human serum samples. Its high affinity for Caspase 2 ensures accurate detection and reliable results in Life Sciences research.

Rabbit polyclonal RUVBL2 antibody

Chicken polyclonal MTBE antibody

KCNIP3 antibody was raised in Rabbit using Human KCNIP3 as the immunogen

Rabbit polyclonal PIGO antibody

IFIT5 antibody was raised in Rabbit using Human IFIT5 as the immunogen

Mouse monoclonal MICAL1 antibody

Mouse monoclonal MPP3 antibody

GLUD1 antibody was raised in Rabbit using Human GLUD1 as the immunogen

The TRIM23 antibody is a powerful tool for researchers in the field of Life Sciences. This antibody specifically targets chemokines and autoantibodies, making it an essential component in various experiments and assays. It has been extensively tested and proven to effectively neutralize interferon-gamma (IFN-gamma) and growth factors, allowing for accurate measurements and analysis. Additionally, the TRIM23 antibody has demonstrated high affinity towards human folate, actin filaments, taxol, and alpha-fetoprotein, making it a versatile option for a wide range of applications. With its exceptional specificity and reliability, this polyclonal antibody is an invaluable asset for any laboratory or research facility. Trust the TRIM23 antibody to deliver consistent results and advance your scientific endeavors.

Affinity purified Rabbit polyclonal VBP1 antibody

The CSA antibody is a powerful tool used in Life Sciences research. It is an antibody that specifically targets and binds to the circumsporozoite protein (CSP), which is found on the surface of the malaria parasite. This antibody can be used to detect the presence of CSP in samples, making it a valuable tool for studying the biology and transmission of malaria.

Protein C antibody was raised using a synthetic peptide corresponding to a region with amino acids MWQLTSLLLFVATWGISGTPAPLDSVFSSSERAHQVLRIRKRANSFLEEL

WDR8 antibody was raised using the middle region of WDR8 corresponding to a region with amino acids GCLSFPPPRAGAGPLPSSESKYEIASVPVSLQTLKPVTDRANPKMGIGML

FGF21 antibody was raised using the N terminal of FGF21 corresponding to a region with amino acids DSDETGFEHSGLWVSVLAGLLLGACQAHPIPDSSPLLQFGGQVRQRYLYT

MLLT3 antibody was raised in Rabbit using Human MLLT3 as the immunogen

HBS1L antibody was raised in Rabbit using Human HBS1L as the immunogen

The KLF4 antibody is a powerful tool used in Life Sciences for ultrasensitive detection and analysis. It is designed to specifically target and bind to the KLF4 protein, which plays a crucial role in cell growth and development. This monoclonal antibody can be used in various applications such as immunoassays, Western blotting, and immunohistochemistry.

FSH beta antibody was raised in mouse using human FSH beta as the immunogen.

Shpk antibody was raised in rabbit using the middle region of Shpk as the immunogen

Rabbit polyclonal ZHX1 antibody

CD11b antibody (Spectral Red) was raised in rat using C57BL/10 murine splenic T-cells and concanavalin A-activted C57BL/10 splenocytes as the immunogen.

CDY1 antibody was raised using the C terminal of CDY1 corresponding to a region with amino acids  FPRTWWQSAEDVHREKIQLDLEAEFYFTHLIVMFKSPRPAAMVLDRSQDF

EIF4G3 antibody was raised in Rabbit using Human EIF4G3 as the immunogen

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.