Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
JMJD5 antibody
JMJD5 antibody was raised in rabbit using the middle region of JMJD5 as the immunogen
Purity:Min. 95%REX1 antibody
The REX1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and detect the presence of cryptosporidium parvum, a parasitic protozoan that causes gastrointestinal infections. The REX1 antibody can be used in immunoassays to identify and quantify the levels of cryptosporidium parvum in samples.
TGF beta 1 antibody
TGF beta 1 antibody was raised in mouse using highly pure recombinant human TGF-beta1 as the immunogen.
ARC antibody
The ARC antibody is a highly specialized antibody that has numerous characteristics and applications in the field of Life Sciences. It is an autoantibody that specifically targets adenine, a crucial molecule involved in various biological processes. The ARC antibody has been extensively studied for its ability to inhibit the growth factor β-catenin, which plays a crucial role in cell proliferation and differentiation.
APC antibody
The APC antibody is a monoclonal antibody that targets the endogenous hematopoietic growth factor known as insulin. This antibody specifically binds to the activated form of APC (activated protein C), which plays a crucial role in anticoagulant and anti-inflammatory processes. The APC antibody has been extensively studied in various life sciences research areas, including cancer biology and angiogenesis. It has shown promising results as an anti-VEGF (vascular endothelial growth factor) therapy, inhibiting the growth of blood vessels and tumor cells. This molecule drug has also been tested in human serum samples, demonstrating its potential clinical applications. In addition to its therapeutic use, polyclonal antibodies targeting APC have been developed for diagnostic purposes in various diseases and disorders.
YAP1 antibody
The YAP1 antibody is a polyclonal antibody that specifically targets the YAP1 protein. This protein plays a crucial role in various cellular processes, including cell proliferation, differentiation, and apoptosis. The YAP1 antibody is designed to recognize and bind to the YAP1 protein, allowing for its detection and analysis in biological samples.
FGF2 antibody
FGF2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Fibrinopeptide A antibody
Fibrinopeptide A antibody was raised in mouse using Fibrinopeptide A conjugated with carrier protein as the immunogen.
AF594 Donkey anti Goat IgG (H + L)
Donkey anti Goat IgG (Heavy + Light chain) secondary antibody with AF594 photostable fluorescent dye label. Minimal cross-reaction with Human, Mouse, Chicken, Rabbit, Guniea Pig, Syrian Hamster, Horse, Rat. Lyophilized from 0.01M Na3PO4, 0.25M NaCl, pH 7.6, with 15mg/ml BSA, and 0.05% NaN3. Reconstitute with 0.4 ml of distilled Water.Purity:Min. 95%PSME3 antibody
PSME3 antibody was raised using the C terminal of PSME3 corresponding to a region with amino acids TVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAETLY
Annexin A3 antibody
Annexin A3 antibody was raised using the N terminal of ANXA3 corresponding to a region with amino acids MASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSN
Keratin 19 antibody
The Keratin 19 antibody is a highly specialized monoclonal antibody that targets the growth factor Keratin 19. It is commonly used in Life Sciences research for various applications such as hybridization studies, high-affinity glucose binding assays, and polymerase chain reactions (PCR). This antibody can also be utilized in the development of polymeric micelles for drug delivery systems and as a tool in gene therapy using adeno-associated virus vectors. Additionally, the Keratin 19 antibody has been shown to play a role in preventing deprivation-induced apoptosis by targeting molecular pathways involved in cell survival. Its specificity towards Keratin 19 makes it an ideal tool for studying sugar transport mechanisms, collagen synthesis, and the effects of compounds like okadaic acid on cellular processes. With its exceptional affinity and versatility, the Keratin 19 antibody is an invaluable asset for researchers exploring a wide range of molecular targets in their scientific investigations.
Lin28B antibody
The Lin28B antibody is an effective molecular inhibitor that has shown promising results as an anticancer agent. It specifically targets the Lin28B protein, a key regulator of cancer progression. By inhibiting the activity of this protein, the antibody can effectively inhibit tumor growth and metastasis. This antibody is a valuable tool in cancer research and can be used in various applications such as chemotherapy and molecular biology studies. With its high specificity and potency, the Lin28B antibody offers great potential for developing novel therapeutic strategies against cancer.
uPAR antibody
The uPAR antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It specifically targets the urokinase plasminogen activator receptor (uPAR), which plays a crucial role in various biological processes such as cell adhesion, migration, and invasion. The uPAR antibody binds to the glycopeptide domain of uPAR, inhibiting its function and preventing the activation of downstream signaling pathways.
Ubiquitin antibody
The Ubiquitin antibody is a highly specific monoclonal antibody that targets the ubiquitin molecule. It is widely used in life sciences research for various applications, including immunoassays and the detection of target molecules. This antibody has been shown to have a high affinity for ubiquitin and can effectively detect its presence in samples.PECAM1 antibody
The PECAM1 antibody is a highly specialized monoclonal antibody derived from a hybridoma cell line. It is designed to target and neutralize the growth factor receptor protein known as platelet endothelial cell adhesion molecule 1 (PECAM1). This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications.
LOC344065 antibody
LOC344065 antibody was raised in rabbit using the middle region of LOC344065 as the immunogen
Purity:Min. 95%Met antibody
Met antibody is a polyclonal antibody that specifically targets the tyrosine kinase receptor known as c-Met. This antibody has neutralizing properties, meaning it can inhibit the activity of c-Met and its downstream signaling pathways. By binding to the protein complex formed by c-Met and its ligand, this antibody prevents the activation of various cellular processes involved in cell growth, survival, migration, and invasion.
Purity:Min. 95%BclxL antibody
The BclxL antibody is a monoclonal antibody that belongs to the class of anti-acth antibodies. It is widely used in Life Sciences research for its ability to detect and target the BclxL protein, a key regulator of apoptosis. This antibody has been shown to exhibit cytotoxic activity against cancer cells by inducing apoptosis through the inhibition of BclxL function. Additionally, it has been found to have inhibitory effects on chemokine and TGF-beta signaling pathways, which play crucial roles in inflammation and immune response. The BclxL antibody can be used in various applications such as Western blotting, immunohistochemistry, and flow cytometry. Its high specificity and affinity make it a valuable tool for studying the role of BclxL in cell survival and growth regulation.
CD45R antibody (Spectral Red)
CD45R antibody (PE) was raised in rat using abelson murine leukemia virus-induced pre-B tumor cells as the immunogen.
Purity:Min. 95%Molecular weight:0 g/mol
