Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
CDY1 antibody
CDY1 antibody was raised using the C terminal of CDY1 corresponding to a region with amino acids FPRTWWQSAEDVHREKIQLDLEAEFYFTHLIVMFKSPRPAAMVLDRSQDF
VWF antibody (HRP)
VWF antibody (HRP) was raised in sheep using Rat vWF purified from plasma as the immunogen.
MCL1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug has been extensively studied using advanced techniques such as transcription-quantitative polymerase chain and patch-clamp technique, which have shown its efficacy in inhibiting bacterial growth. Additionally, it undergoes various metabolic transformations including hydrolysis by esterases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Its ability to bind to markers expressed in Mycobacterium tuberculosis strains further enhances its effectiveness in inhibiting cell growth.
PGD antibody
The PGD antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to alpha-fetoprotein, a protein that is associated with various diseases and conditions. The PGD antibody has been extensively tested and proven to be highly specific and sensitive in detecting alpha-fetoprotein in human serum samples. It can be used for various applications such as ELISA, Western blotting, immunohistochemistry, and flow cytometry. The PGD antibody can also be conjugated with different markers or enzymes for enhanced detection and visualization. With its high affinity and cytotoxic properties, the PGD antibody holds great potential for targeted therapy in the future.
LIF antibody
The LIF antibody is a polyclonal antibody used in the field of Life Sciences. It specifically targets and inhibits the activity of leukemia inhibitory factor (LIF), which is an important growth factor involved in various cellular processes. This antibody can be used to study the role of LIF in different biological systems, including liver microsomes and hybridoma cells. By blocking the action of LIF, this antibody can potentially have cytotoxic effects on specific cell types, such as cholinergic and catecholaminergic neurons. Additionally, it may be useful for investigating the effects of LIF inhibitors on dopamine signaling pathways. With its high specificity and potency, the LIF antibody is a valuable tool for researchers studying the function and regulation of LIF in various physiological and pathological conditions.
EXOC6 antibody
EXOC6 antibody was raised using the middle region of EXOC6 corresponding to a region with amino acids YRCLHIYSVLGDEETFENYYRKQRKKQARLVLQPQSNMHETVDGYRRYFT
QSOX1 antibody
The QSOX1 antibody is a monoclonal antibody that plays a crucial role in neutralizing the growth factor and steroid histidine. It is widely used in Life Sciences for its ability to target and bind to specific antigens, facilitating various research applications. This high-quality antibody is produced through hybridization techniques, ensuring its specificity and efficacy. The QSOX1 antibody has shown promising results in studies related to enzastaurin, dopamine, and natriuretic factors. It can also be utilized for the detection of autoantibodies and antigen-antibody reactions. With its exceptional binding capabilities, this monoclonal antibody is an invaluable tool for researchers in the field of Life Sciences.
CYTL1 antibody
The CYTL1 antibody is a highly specialized antibody that plays a crucial role in various biological processes. It belongs to the class of polyclonal antibodies and is specifically designed to target and neutralize the effects of CYTL1.
Hsp90 antibody
The Hsp90 antibody is a polyclonal antibody that is widely used in life sciences research. It is commonly used in vitro assays to detect and quantify the presence of Hsp90, a protein that plays a crucial role in cellular processes. This antibody specifically recognizes the Hsp90 protein by binding to specific amino acid residues on its surface.
NRF1 antibody
The NRF1 antibody is a powerful tool used in life sciences research. It specifically targets the nuclear respiratory factor 1 (NRF1), a transcription factor that plays a crucial role in regulating the expression of genes involved in cellular energy metabolism and mitochondrial biogenesis. This antibody is highly specific, binding to the carbonyl group of lysine residues on NRF1 with high affinity.
Annexin I antibody
The Annexin I antibody is a valuable tool in the field of Life Sciences. It is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs. This antibody has been extensively tested and proven to be highly effective in a variety of applications.
PELI1 antibody
The PELI1 antibody is an anti-HER2 antibody that plays a crucial role in endocytic uptake. It is widely used in the field of Life Sciences for various applications. This antibody specifically targets HER2, a protein that is overexpressed in certain cancer cells, including breast cancer. By binding to HER2, the PELI1 antibody inhibits its signaling pathway and prevents the growth and proliferation of cancer cells.
Ketamine antibody
Ketamine antibody is a monoclonal antibody that specifically targets sclerostin, a protein involved in bone metabolism. This antibody can be used in various assays to detect and quantify sclerostin levels in biological samples. The high specificity and sensitivity of this antibody make it an ideal tool for research in the field of bone biology and related diseases. Additionally, the colloidal gold conjugation of this antibody allows for easy visualization and detection in immunoassays. Whether you are studying the role of sclerostin in osteoporosis or investigating potential therapeutic interventions, this ketamine antibody is an essential tool for your research.
Phosphothreonine antibody (biotin)
Phosphothreonine antibody (biotin) was raised in rabbit using phosphothreonine-KLH and phosvitin mixture as the immunogen.
RAGE antibody
The RAGE antibody is a monoclonal antibody that specifically targets the receptor for advanced glycation end products (RAGE). It is derived from human serum albumin and has been shown to have neutralizing properties against various growth factors, chemokines, and epidermal growth factor-like molecules. The RAGE antibody works by inhibiting the binding of these molecules to RAGE, thereby preventing their downstream signaling pathways. This antibody can be used in various life science research applications, such as immunohistochemistry, Western blotting, and flow cytometry. Additionally, polyclonal antibodies are also available for those who require a broader range of target recognition. With its high specificity and inhibitory effects, the RAGE antibody is a valuable tool for studying the role of RAGE in various biological processes.
Androgen Receptor antibody
The Androgen Receptor antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody specifically designed to target the androgen receptor, a steroid receptor protein that plays a crucial role in mediating the effects of androgens in various biological processes. This antibody can be used for a wide range of applications, including immunoassays, neutralizing experiments, and as a probe for detecting the presence of the androgen receptor.
IVD antibody
IVD antibody is a reactive growth factor that belongs to the class of monoclonal antibodies. It specifically targets cysteine-rich proteins and can be used to detect autoantibodies in various assays. The IVD antibody has high affinity for tumor necrosis factor-alpha (TNF-α), a glycoprotein involved in inflammation and immune response. This antibody can be used in immunohistochemistry, Western blotting, and other techniques such as electrophoresis to study protein expression and localization. Additionally, the IVD antibody has been shown to modulate transmembrane conductance and act as an angiogenic inducer by targeting chemokines and activated cells. Overall, this versatile monoclonal antibody offers a valuable tool for researchers studying various biological processes and diseases.
FGF21 antibody
FGF21 antibody was raised using the N terminal of FGF21 corresponding to a region with amino acids DSDETGFEHSGLWVSVLAGLLLGACQAHPIPDSSPLLQFGGQVRQRYLYT
Purity:Min. 95%Goat anti Mouse IgG (H + L) (HRP)
This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.
Purity:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productCA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
