Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
KIAA0859 antibody
KIAA0859 antibody was raised using the C terminal of KIAA0859 corresponding to a region with amino acids NEILFCQLHPEQKLATPELLETAQALERTLRKPGRGWDDTYVLSDMLKTV
BCOR antibody
The BCOR antibody is a monoclonal antibody that specifically targets the necrosis factor-related apoptosis-inducing protein. This antibody has been widely used in Life Sciences research to study various biological processes, including amyloid plaque formation and cell death pathways. The BCOR antibody exhibits high specificity and affinity for its target and has been extensively characterized for its binding properties. It is also serum albumin-binding, which allows for efficient delivery and distribution in vivo. This antibody can be used in a variety of applications, such as immunohistochemistry, Western blotting, and ELISA assays. Whether you are studying erythropoietin signaling or investigating growth factors involved in low-density lipoprotein metabolism, the BCOR antibody is an invaluable tool for your research needs. Choose this highly reliable and validated monoclonal antibody to ensure accurate and reproducible results in your experiments.
PDIA4 antibody
PDIA4 antibody was raised using the N terminal of PDIA4 corresponding to a region with amino acids ENAIEDEEEEEEEDDDEEEDDLEVKEENGVLVLNDANFDNFVADKDTVLL
Purity:Min. 95%ABCB1 antibody
ABCB1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purity:Min. 95%NUDT18 antibody
NUDT18 antibody was raised using a synthetic peptide corresponding to a region with amino acids MASEGLAGALASVLAGQGSSVHSCDSAPAGEPPAPVRLRKNVCYVVLAVF
Lin28B antibody
The Lin28B antibody is an effective molecular inhibitor that has shown promising results as an anticancer agent. It specifically targets the Lin28B protein, a key regulator of cancer progression. By inhibiting the activity of this protein, the antibody can effectively inhibit tumor growth and metastasis. This antibody is a valuable tool in cancer research and can be used in various applications such as chemotherapy and molecular biology studies. With its high specificity and potency, the Lin28B antibody offers great potential for developing novel therapeutic strategies against cancer.
PSMD4 antibody
The PSMD4 antibody is a neutralizing monoclonal antibody that targets antiphospholipid antibodies. It is used as a test substance in various research applications, including in vitro and in vivo studies. This antibody specifically binds to the PSMD4 protein, which is an essential component of the 26S proteasome. The PSMD4 antibody has been shown to effectively neutralize the activity of autoantibodies, preventing their harmful effects on cells and tissues. It can be used in immunoassays to detect the presence of PSMD4 or as a tool for studying its function and interactions with other molecules. With its high specificity and affinity for PSMD4, this monoclonal antibody is a valuable resource for researchers in the field of Life Sciences.
AVPV2 antibody
AVPV2 antibody was raised in rabbit using 21aa peptide of rat AVPV2 receptor. as the immunogen.Purity:Min. 95%RAB32 antibody
The RAB32 antibody is a monoclonal antibody that targets the RAB32 protein. This protein plays a crucial role in various cellular processes, including the regulation of superoxide production and growth factor signaling. The RAB32 antibody has been shown to effectively neutralize the activity of RAB32, making it a valuable tool for researchers in the field of Life Sciences.
PD1 antibody
PD1 antibody is a protein that belongs to the family of antibodies. It plays a crucial role in regulating the immune response and preventing autoimmune diseases. PD1 antibody binds to the programmed cell death protein 1 (PD-1), which is expressed on the surface of T cells, B cells, and other immune cells. By binding to PD-1, this antibody blocks its interaction with programmed death-ligand 1 (PD-L1) and programmed death-ligand 2 (PD-L2), inhibiting the inhibitory signals that suppress T cell activation.
P2RX2 antibody
P2RX2 antibody was raised using the N terminal of P2RX2 corresponding to a region with amino acids MAAAQPKYPAGATARRLARGCWSALWDYETPKVIVVRIHRAEKLPGERDG
Fibronectin 1 antibody
Fibronectin 1 antibody was raised using the N terminal of FN1 corresponding to a region with amino acids GNALVCTCYGGSRGFNCESKPEAEETCFDKYTGNTYRVGDTYERPKDSMIPurity:Min. 95%CD8 antibody (Spectral Red)
CD8 antibody (Spectral Red) was raised in mouse using human CD8 as the immunogen.
CD28 antibody
CD28 antibody was raised in rabbit using residues 72-85 [SQQLQVYSKTGFN] of the Ig-V region of human CD28 as the immunogen.Purity:Min. 95%RhoA antibody
The RhoA antibody is a powerful tool in the field of Life Sciences. It is a highly specific antibody that targets RhoA, a small GTPase protein involved in various cellular processes. This antibody can be used in both research and clinical settings to study the role of RhoA in different biological pathways.
SET antibody
SET antibody was raised using the N terminal of SET corresponding to a region with amino acids IDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVT
Purity:Min. 95%PNMT antibody
The PNMT antibody is an extracellular antigen that plays a crucial role in reductive processes. It can be used in various applications, including adeno-associated virus research and the development of therapeutic antibodies. The PNMT antibody is a highly specific monoclonal antibody that targets the activated form of the PNMT protein complex. It has been extensively tested and shown to have neutralizing properties against multidrug-resistant strains. This antibody is widely used in the life sciences field for its ability to detect and study low-density protein complexes. With its high specificity and soluble nature, the PNMT antibody is an invaluable tool for researchers in need of reliable and accurate detection methods.
NRIP1 antibody
NRIP1 antibody was raised in mouse using recombinant Human Nuclear Receptor Interacting Protein 1 (Nrip1)SMAD2 antibody
The SMAD2 antibody is a highly specialized biomolecule that plays a crucial role in the field of Life Sciences. This monoclonal antibody is designed to specifically target and neutralize SMAD2, a key protein involved in various cellular processes. It has been extensively studied for its potential applications in research and therapeutic settings.
Purity:Min. 95%Goat anti Bovine IgG (H + L) (FITC)
Goat anti-Bovine IgG (H + L) (FITC) was raised in goat using purified Bovine IgG (H&L) as the immunogen.
Purity:Min. 95%FAM135B antibody
FAM135B antibody was raised using the middle region of FAM135B corresponding to a region with amino acids TLVSTGLWLMQKLKKSGSLLQLTFRDNADLRKCFLYQLSQKTGLQYFKNV
TACC3 antibody
The TACC3 antibody is a highly specialized antibody that plays a crucial role in various biological processes. It is commonly used in the field of Life Sciences for research purposes. This antibody specifically targets TACC3, which stands for transforming acidic coiled-coil-containing protein 3. TACC3 is involved in cell division, growth regulation, and development.
