Primary Antibodies

Rabbit polyclonal CYB5 antibody (HRP)

Purified Polyclonal Profilin 2 antibody

The IGFBP3 antibody is a highly specialized antibody used in Life Sciences research. It is immobilized and specifically designed to target and bind to the IGFBP3 antigen. This monoclonal antibody has been extensively tested and validated for its specificity and sensitivity in detecting IGFBP3 in various experimental settings.

The GPR158 antibody is a monoclonal antibody that specifically targets GPR158, a cationic receptor involved in various biological processes. This antibody has been extensively tested and validated for its specificity and effectiveness in scientific research. It can be used in a wide range of applications, including immunohistochemistry, Western blotting, and ELISA.

Rabbit polyclonal TRMT5 antibody

Rabbit polyclonal PSMB9 antibody

Purified Polyclonal AKAP10 antibody

GJC3 antibody was raised in rabbit using the middle region of GJC3 as the immunogen

The GLUT4 antibody is a glycoprotein that plays a crucial role in glucose metabolism. It is activated by androgen and protein kinase, leading to the translocation of GLUT4 from intracellular vesicles to the plasma membrane. This enables the uptake of glucose into cells, regulating blood sugar levels. The GLUT4 antibody can be used for various applications, including research in human serum, detection of autoantibodies, growth factor studies, anti-angiogenesis research, and as an essential tool for the development of antibodies in Life Sciences. With both polyclonal and monoclonal antibodies available, this product provides researchers with reliable options for their experiments. Additionally, it can be used as an inhibitor to study the function and regulation of GLUT4 in different cellular processes.

The AFP antibody is a highly specialized monoclonal antibody that has been developed for various applications in the field of biomedical research. This antibody specifically targets and binds to alpha-fetoprotein (AFP), a human protein that is commonly found in the serum of individuals with certain medical conditions.

The Tau antibody is a highly specialized monoclonal antibody that targets the insulin protein. It has been extensively studied in the field of Life Sciences and has shown remarkable potential for neutralizing insulin activity. This antibody specifically binds to insulin, inhibiting its function and preventing it from interacting with its receptors.

Rabbit polyclonal IKBE antibody (Ser22)

Rabbit polyclonal RNPEP antibody

CD203c antibody is a highly specialized antibody used in the field of Life Sciences. It is designed to target and bind to DNA binding proteins that play a crucial role in various cellular processes. This antibody has been extensively studied and proven to be effective in glycosylation studies, where it helps researchers understand the role of glycosylation in protein function and regulation.

Goat anti Human IgE antibody

Rabbit anti-cat IgG (H+L) (biotin) was raised in rabbit using feline IgG whole molecule as the immunogen.

The c-Jun antibody is a powerful tool used in Life Sciences research. It is a monoclonal antibody that specifically targets and binds to the c-Jun protein. This protein plays a crucial role in various cellular processes, including fibronectin production, endothelial growth, and the regulation of interleukin-6 and epidermal growth factor.

The GPR132 antibody is a highly specialized chemokine that is activated in human serum. It is widely used in the field of Life Sciences and Antibodies for its ability to target specific growth factors, such as alpha-fetoprotein, and adipose tissues. This monoclonal antibody has a neutralizing effect on receptor binding, making it an effective tool for blocking specific pathways. The GPR132 antibody is commonly used in research settings, where it can be conjugated with colloidal phosphatase or other markers to facilitate detection. Its versatility and effectiveness make it an invaluable tool for studying various biological processes and identifying potential therapeutic targets.

The SMAD2 antibody is a highly specialized Monoclonal Antibody that targets the EGF-like domain of the SMAD2 protein. It is widely used in research and bioassays to study the role of SMAD2 in various cellular processes. This antibody specifically recognizes the glial fibrillary acidic protein (GFAP), a key marker for astrocytes and reactive gliosis. It has been shown to have neutralizing activity against GFAP, making it an effective tool for studying the functions and regulation of this important glycoprotein.

The TFE3 antibody is a monoclonal antibody that specifically targets CD33, an antigen expressed on the surface of certain cells. It belongs to the class of anti-CD33 antibodies and is widely used in life sciences research. The TFE3 antibody has been shown to bind to CD33 with high affinity, effectively blocking receptor binding and modulating downstream signaling pathways. This antibody can be used for various applications, including flow cytometry, immunohistochemistry, and western blotting. Additionally, the TFE3 antibody has been used in studies investigating autoimmune diseases, such as rheumatoid arthritis and systemic lupus erythematosus. Its ability to neutralize TNF-α and inhibit the activation of immune cells makes it a valuable tool in immunology research. Furthermore, this antibody has shown potential therapeutic effects in preclinical models of cancer by targeting CD33-expressing tumor cells. With its versatility and wide range of applications, the TFE3 antibody is an essential tool for

MIER1 antibody was raised in Rabbit using Human MIER1 as the immunogen

Rabbit polyclonal URM1 antibody

TSH antibody was raised in rabbit using human TSH as the immunogen.

The Lin28B antibody is an effective molecular inhibitor that has shown promising results as an anticancer agent. It specifically targets the Lin28B protein, a key regulator of cancer progression. By inhibiting the activity of this protein, the antibody can effectively inhibit tumor growth and metastasis. This antibody is a valuable tool in cancer research and can be used in various applications such as chemotherapy and molecular biology studies. With its high specificity and potency, the Lin28B antibody offers great potential for developing novel therapeutic strategies against cancer.

Chromogranin A antibody was raised in mouse using human pheochromocytoma as the immunogen.

RHOU antibody was raised using the C terminal of RHOU corresponding to a region with amino acids LKEVFDAAIVAGIQYSDTQQQPKKSKSRTPDKMKNLSKSWWKKYCCFV

HIV1 antibody (HTLV3) (FITC) was raised in goat using human isolate as the immunogen.

Rabbit polyclonal SERPINH1 antibody

BD1 antibody was raised in rabbit using highly pure recombinant human BD-1 as the immunogen.

Human kappa light chain antibody was raised in mouse using a constantly expressed epitope of kappa chain as the immunogen.

CRP antibody was raised in mouse using human CRP derived from pleural/ascetic fluid or plasma as the immunogen.

LRMP antibody was raised in Rabbit using Human LRMP as the immunogen

MVP antibody was raised using the N terminal of MVP corresponding to a region with amino acids MATEEFIIRIPPYHYIHVLDQNSNVSRVEVGPKTYIRQDNERVLFAPMRM

Human IgM antibody (Poly-HRP) was raised in mouse using human IgM as the immunogen.

RNF19A antibody was raised using the N terminal of RNF19A corresponding to a region with amino acids IFSTNTSSDNGLTSISKQIGDFIECPLCLLRHSKDRFPDIMTCHHRSCVD

Rabbit polyclonal SECP43 antibody

EphB1 antibody was raised in Mouse using a purified recombinant fragment of EphB1(aa19-133) expressed in E. coli as the immunogen.

CEA antibody was raised in mouse using human colon adrenocarcinoma as the immunogen.

Gabrp antibody was raised in rabbit using the N terminal of Gabrp as the immunogen

Rabbit polyclonal NUDT19 antibody

DIDO1 antibody was raised in rabbit using the C terminal of DIDO1 as the immunogen