Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
Fibronectin antibody (biotin)
Fibronectin antibody was raised in rabbit using fibronectin purified from human plasma as the immunogen.
Lactoferrin antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. This drug has been extensively studied and proven to be active using advanced techniques like the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting their cell growth in culture.GRPEL1 antibody
GRPEL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NSGQNLEEDMGQSEQKADPPATEKTLLEEKVKLEEQLKETVEKYKRALAD
RARA antibody
The RARA antibody is a neutralizing monoclonal antibody that targets the endothelial growth factor. It has been shown to inhibit the growth and proliferation of cells involved in angiogenesis, making it a promising therapeutic option for various diseases related to abnormal blood vessel formation. This antibody specifically binds to fibronectin and collagen, forming a protein complex that disrupts the signaling pathways involved in angiogenesis. In addition, the RARA antibody has been found to have inhibitory effects on alpha-fetoprotein, a growth factor associated with certain types of cancer. Its potential applications in the field of life sciences make it an exciting area of research and development.
ADA antibody
ADA antibody was raised using the middle region of ADA corresponding to a region with amino acids ANYSLNTDDPLIFKSTLDTDYQMTKRDMGFTEEEFKRLNINAAKSSFLPEPurity:Min. 95%TST antibody
The TST antibody is a polyclonal antibody that has been developed as an anti-connexin agent. It is designed to target connexins, which are proteins involved in cell communication. This antibody has been extensively tested and shown to be highly effective in neutralizing connexin activity.
ZKSCAN1 antibody
ZKSCAN1 antibody was raised in rabbit using the N terminal of ZKSCAN1 as the immunogen
Purity:Min. 95%CYP2J2 antibody
The CYP2J2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is specifically designed to target and detect the CYP2J2 enzyme, which plays a crucial role in the metabolism of drugs and other foreign substances in the body. This antibody is commonly used in studies involving mesenchymal stem cells, reactive oxygen species, and electrode-based assays.
HAO1 antibody
HAO1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLNGILVSNHGARQLDGVPATIDVLPEIVEAVEGKVEVFLDGGVRKGTDV
Gabrp antibody
Gabrp antibody was raised in rabbit using the N terminal of Gabrp as the immunogen
Purity:Min. 95%Donkey anti Guinea Pig IgG (H + L) (Cy3)
Donkey anti-guinea pig IgG (H + L) (Cy3) was raised in donkey using guinea pig IgG (H & L) as the immunogen.
Purity:Min. 95%PNMT antibody
The PNMT antibody is a powerful tool used in Life Sciences research. It is a monoclonal antibody that specifically targets the enzyme phenylethanolamine N-methyltransferase (PNMT). This enzyme plays a crucial role in the synthesis of the neurotransmitter norepinephrine.
BBS5 antibody
BBS5 antibody was raised using the middle region of BBS5 corresponding to a region with amino acids VEIDSDGHTDAFVAYFADGNKQQDREPVFSEELGLAIEKLKDGFTLQGLW
Tetraspanin 31 antibody
Tetraspanin 31 antibody was raised using the middle region of TSPAN31 corresponding to a region with amino acids CTAICKSQSPTCQMCGEKFLKHSDEALKILGGVGLFFSFTEILGVWLAMRPurity:Min. 95%SMAD2 antibody
The SMAD2 antibody is a highly specialized Monoclonal Antibody that targets the EGF-like domain of the SMAD2 protein. It is widely used in research and bioassays to study the role of SMAD2 in various cellular processes. This antibody specifically recognizes the glial fibrillary acidic protein (GFAP), a key marker for astrocytes and reactive gliosis. It has been shown to have neutralizing activity against GFAP, making it an effective tool for studying the functions and regulation of this important glycoprotein.
Protein S antibody
Protein S antibody was raised in sheep using human Protein S purified from plasma as the immunogen.Purity:Min. 95%IGFBP3 antibody
The IGFBP3 antibody is a highly specialized antibody used in Life Sciences research. It is immobilized and specifically designed to target and bind to the IGFBP3 antigen. This monoclonal antibody has been extensively tested and validated for its specificity and sensitivity in detecting IGFBP3 in various experimental settings.
Purity:Min. 95%BTN3A2 antibody
The BTN3A2 antibody is a monoclonal antibody that is widely used in the field of Life Sciences. It specifically targets the BTN3A2 protein, which plays a crucial role in various biological processes. This antibody has been extensively studied and proven to be highly specific and sensitive in detecting the presence of BTN3A2.
U1SNRNPBP antibody
U1SNRNPBP antibody was raised using the N terminal of U1SNRNPBP corresponding to a region with amino acids RAVWRAMLARYVPNKGVIGDPLLTLFVARLNLQTKEDKLKEVFSRYGDIR
Desmoplakin 1+2 antibody
Desmoplakin 1+2 antibody was raised in mouse using C-terminal polypeptide of recombinant human desmoplakin as the immunogen.
PRPF6 antibody
PRPF6 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGKRTVGDQMKKNQAADDDDEDLNDTNYDEFNGYAGSLFSSGPYEKDDEE
Aggrecan antibody
The Aggrecan antibody is a highly effective neutralizing agent used in the field of Life Sciences. This antibody is specifically designed to target and inhibit the activity of aggrecan, a growth factor that plays a crucial role in various biological processes. It has been extensively studied for its potential applications in mesenchymal stem cell research, as well as its ability to modulate TGF-beta signaling pathways.
BCOR antibody
The BCOR antibody is a monoclonal antibody that specifically targets the necrosis factor-related apoptosis-inducing protein. This antibody has been widely used in Life Sciences research to study various biological processes, including amyloid plaque formation and cell death pathways. The BCOR antibody exhibits high specificity and affinity for its target and has been extensively characterized for its binding properties. It is also serum albumin-binding, which allows for efficient delivery and distribution in vivo. This antibody can be used in a variety of applications, such as immunohistochemistry, Western blotting, and ELISA assays. Whether you are studying erythropoietin signaling or investigating growth factors involved in low-density lipoprotein metabolism, the BCOR antibody is an invaluable tool for your research needs. Choose this highly reliable and validated monoclonal antibody to ensure accurate and reproducible results in your experiments.
CACNB4 antibody
CACNB4 antibody was raised using the C terminal of CACNB4 corresponding to a region with amino acids LEAYWRATHTTSSTPMTPLLGRNLGSTALSPYPTAISGLQSQRMRHSNHS
BRAF antibody
The BRAF antibody is a powerful tool in the field of Life Sciences. It is an inhibitor that specifically targets BRAF, a protein involved in cell growth and division. This antibody has been extensively studied for its potential therapeutic applications in various diseases, including cancer.
