Primary Antibodies

<p>MRPL37 antibody was raised in Rabbit using Human MRPL37 as the immunogen</p>

<p>The PAK4 antibody is a protein that specifically targets and neutralizes the activity of PAK4. It belongs to the class of polyclonal antibodies, which are widely used in life sciences research. PAK4 is an important enzyme involved in various cellular processes, including cell migration, proliferation, and survival. The PAK4 antibody can be used in experiments to study the role of PAK4 in these processes. It can also be used as a diagnostic tool to detect the presence of autoantibodies against PAK4 in certain diseases. Additionally, monoclonal antibodies targeting PAK4 have been developed and can be used as therapeutic agents to inhibit its activity. The PAK4 antibody is available as both polyclonal and monoclonal forms, and it has been extensively validated for its specificity and efficacy.</p>

<p>NEUROD1 antibody was raised in Rabbit using Human NEUROD1 as the immunogen</p>

<p>ETFB antibody was raised using the C terminal of ETFB corresponding to a region with amino acids TADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDPP</p>

<p>KCNF1 antibody was raised in Rabbit using Human KCNF1 as the immunogen</p>

<p>Rabbit polyclonal RAPGEFL1 antibody</p>

<p>The AKT1 antibody is a powerful tool used in Life Sciences research. This antibody specifically targets the AKT1 protein, which plays a crucial role in cell growth, survival, and metabolism. By binding to AKT1, this antibody can effectively block its activity and inhibit downstream signaling pathways.</p>

<p>The FSH antibody is a highly specialized immunohistochemistry tool used in the field of Life Sciences. It specifically targets the tumor necrosis factor-alpha (TNF-α) and acts as a kinase receptor growth factor. This polyclonal antibody plays a crucial role in binding proteins and cytotoxicity, particularly against tyrosine kinase receptors.</p>

<p>The STAT6 antibody is a specific antibody that binds to the receptor of STAT6, a growth factor involved in various cellular processes. This antibody is designed to recognize and bind to the specific disulfide bond on the STAT6 receptor, blocking its activity and preventing downstream signaling. The STAT6 antibody is a monoclonal antibody derived from human protein and has been extensively tested for its efficacy and specificity. It forms dimers with other antibodies, such as afatinib, to enhance its cytotoxic effects. In Life Sciences research, the STAT6 antibody is commonly used for immunohistochemistry, Western blotting, and hybridization studies. It can also be used in diagnostic applications to detect the presence of alpha-msh or other related proteins. Additionally, polyclonal antibodies can be generated using the STAT6 antibody as an antigen for immunization. These polyclonal antibodies are valuable tools for studying the role of STAT6 in various biological processes.</p>

<p>PTH antibody was raised in goat using human PTH as the immunogen.</p>

<p>INSR antibody was raised in Rabbit using Human INSR as the immunogen</p>

<p>The STAT2 antibody is a polyclonal antibody that targets the STAT2 molecule. It is commonly used in research and assays related to androgen signaling, low-density lipoprotein metabolism, autoantibodies, and inhibitors. This antibody has been shown to be effective in detecting and quantifying STAT2 expression in various cell types, including MCF-7 cells. In addition, it is widely used in life sciences research to study the regulation of cortisol concentration and the role of STAT2 in immune responses. The STAT2 antibody is a valuable tool for researchers looking to investigate the function and activation of this important signaling molecule.</p>

<p>MPS1 antibody was raised in Mouse using a purified recombinant fragment of MPS1 expressed in E. coli as the immunogen.</p>

<p>HPV18 antibody was raised in mouse using papilloma virus type 18 as the immunogen.</p>

<p>The SSRP1 antibody is a highly potent growth factor that acts as a phosphatase in various bioassays. It is specifically activated by human serum and has neutralizing properties. This antibody, widely used in Life Sciences research, targets tyrosine kinase receptors and 3-kinases to regulate cellular processes. It can be utilized in electrode-based experiments and is commonly employed in the field of Antibodies research. Additionally, the SSRP1 antibody has been found to exhibit genotoxic effects and shows potential as an anti-beta amyloid agent for combating amyloid protein-related disorders.</p>

<p>Rabbit polyclonal SCN1B antibody</p>

<p>ACTL7B antibody was raised using the middle region of ACTL7B corresponding to a region with amino acids KLITIGQERFRCSEMLFQPSLAGSTQPGLPELTAACLGRCQDTGFKEEMA</p>

<p>NFYA antibody was raised in Rabbit using Human NFYA as the immunogen</p>

<p>Rabbit polyclonal RDH12 antibody</p>

<p>Granzyme B antibody (PE) was raised in mouse using human granzyme B as the immunogen.</p>

<p>Rabbit polyclonal LRP2 antibody</p>

<p>WASF3 antibody was raised using the N terminal of WASF3 corresponding to a region with amino acids NMKKAFKSSTVQDQQVVSKNSIPNPVADIYNQSDKPPPLNILTPYRDDKK</p>

<p>PDS5B antibody was raised using a synthetic peptide corresponding to a region with amino acids DEQQWPEEKRLKEDILENEDEQNSPPKKGKRGRPPKPLGGGTPKEEPTMK</p>

<p>Monoclonal antibody to PCSK9 ; inhibitor of proprotein convertase PCSK9</p>