Primary Antibodies

<p>FAM98A antibody was raised using the middle region of FAM98A corresponding to a region with amino acids QKRQDGPQQQTGGRGGGRGGYEHSSYGGRGGHEQGGGRGGRGGYDHGGRG</p>

<p>PPIH antibody was raised using a synthetic peptide corresponding to a region with amino acids DFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTN</p>

<p>The Calcitonin antibody is an anti-connexin agent that specifically targets transthyretin. It is used for immobilization on electrodes and in interferon assays. This monoclonal antibody has been shown to be highly effective in detecting and quantifying activated tyrosine in human serum, making it a valuable tool in Life Sciences research. With its high specificity and sensitivity, this antibody is widely used in various applications, including antigen detection and characterization. Trust the Calcitonin antibody to deliver accurate and reliable results in your research endeavors.</p>

<p>HLA-DQA2 antibody was raised using the middle region of HLA-DQA2 corresponding to a region with amino acids LPMFSKFISFDPQSALRNMAVGKHTLEFMMRQSNSTAATNEVPEVTVFSK</p>

<p>HNRPL antibody was raised using the N terminal of HNRPL corresponding to a region with amino acids RRRSGAMVKMAAAGGGGGGGRYYGGGSEGGRAPKRLKTDNAGDQHGGGGG</p>

<p>SLC22A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSCVDPLASLATNRSHLPLGPCQDGWVYDTPGSSIVTEFNLVCADSWKLD</p>

<p>DNAL4 antibody was raised in Rabbit using Human DNAL4 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal DDAH1 antibody</p>

<p>TBC1D14 antibody was raised using the N terminal of TBC1D14 corresponding to a region with amino acids MTDGKLSTSTNGVAFMGILDGRPGNPLQNLQHVNLKAPRLLSAPEYGPKL</p>

<p>Rabbit polyclonal Annexin A2 antibody (FITC)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug from the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been demonstrated through patch-clamp techniques on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation. Additionally, it specifically binds to markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture.</p>

<p>CORO1C antibody was raised in Rabbit using Human CORO1C as the immunogen</p>

<p>The MTAP antibody is a highly specialized product in the field of Life Sciences. It is a nuclear monoclonal antibody that has been developed for various applications, including antinociceptive research. This antibody specifically targets the retinoid-binding protein MTAP, which is found in high levels in certain tissues and cells.</p>

<p>Affinity purified Rabbit polyclonal BCAT2 antibody</p>

<p>DDC antibody was raised using a synthetic peptide corresponding to a region with amino acids EFRRRGKEMVDYVANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFE</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known for its bactericidal activity against tuberculosis infection and contains active compounds that effectively inhibit bacterial growth. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. The metabolization process involves hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, this drug specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting their cell growth in culture.</p>

<p>NECAP1 antibody was raised in Rabbit using Human NECAP1 as the immunogen</p>

<p>Purified Polyclonal PRKX antibody</p>

<p>BBS4 antibody was raised using the N terminal of BBS4 corresponding to a region with amino acids YVQALIFRLEGNIQESLELFQTCAVLSPQSADNLKQVARSLFLLGKHKAA</p>

<p>ARHGEF1 antibody was raised in Rabbit using Human ARHGEF1 as the immunogen</p>

<p>Purified Rabbit polyclonal MYB27 antibody</p>

<p>Affinity purified Rabbit polyclonal I309 antibody</p>

<p>Rabbit polyclonal argF antibody (FITC)</p>

<p>PDP2 antibody was raised using the middle region of PDP2 corresponding to a region with amino acids LQRSILERGFNTEALNIYQFTPPHYYTPPYLTAEPEVTYHRLRPQDKFLV</p>

<p>The PR8 antibody is a highly specialized collagen antibody that targets specific proteins in the body. It has been extensively studied and proven to inhibit the activity of protein kinases, which play a crucial role in various cellular processes. This antibody has also been shown to effectively block the interaction between peptide mimics and microvessel endothelial cells, preventing the formation of abnormal blood vessels.</p>

<p>HPRT antibody was raised in mouse using recombinant human HPRT (1-218aa) purified from E. coli as the immunogen.</p>

<p>EIF3F antibody was raised in rabbit using the N terminal of EIF3F as the immunogen</p>

<p>ACTR1A antibody was raised in Rabbit using Human ACTR1A as the immunogen</p>

<p>Affinity purified Rabbit polyclonal Proteasome 20S alpha 7 antibody</p>

<p>Influenza B antibody (biotin) was raised in goat using the yamagata strain of influenza B as the immunogen.</p>

<p>MSI2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHEL</p>

<p>Purified Rabbit polyclonal EPHA7 antibody (Tyr791)</p>

<p>Rabbit polyclonal E2F6 antibody</p>

<p>The WTAP antibody is a powerful tool in life sciences research. It is an antibody that specifically targets the WTAP protein, which plays a crucial role in various cellular processes. This antibody has been extensively studied and validated for its high specificity and sensitivity.</p>

<p>Purified Polyclonal ZNF9 antibody</p>

<p>The p53 antibody is a highly specialized monoclonal antibody that is used in the field of Life Sciences for various applications. This antibody is specifically designed to bind to the p53 protein, which plays a crucial role in regulating cell growth and preventing tumor formation. By targeting this protein, the p53 antibody can be used to study its activation status and evaluate its potential as a therapeutic target.</p>

<p>ACCN1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GDIGGQMGLFIGASILTILELFDYIYELIKEKLLDLLGKEEDEGSHDENV</p>

<p>Affinity purified Rabbit polyclonal GPR114 antibody</p>

<p>ARFGAP1 antibody was raised in Rabbit using Human ARFGAP1 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal Profilin 2 antibody</p>

<p>Affinity purified Rabbit polyclonal APBB3 antibody</p>

<p>Rabbit polyclonal ATP5D antibody</p>

<p>The CBG antibody is a highly specialized antibody-drug that belongs to the class of polyclonal antibodies. It has been extensively studied in the field of Life Sciences and has shown promising results in various applications. This antibody specifically targets insulin-like growth factor and thrombocytopenia, making it a valuable tool for researchers studying these areas.</p>

<p>Rabbit polyclonal PGD antibody (HRP)</p>

<p>Rabbit Polyclonal ASK1 antibody (Ser83)</p>

<p>Rabbit polyclonal MED12 antibody</p>

<p>The BPGM antibody is a powerful tool used in chemotherapy and various Life Sciences research applications. It belongs to the class of antibodies that specifically target BPGM (bisphosphoglycerate mutase), an enzyme involved in the metabolism of glucose. This antibody has high affinity for BPGM and can be used in various assays to detect its presence or measure its activity.</p>

<p>Rabbit polyclonal HSPF1 antibody</p>

<p>FAF1 antibody was raised in rabbit using the middle region of FAF1 as the immunogen</p>

Affinity purified Rabbit polyclonal SLC10A1 antibody

<p>The Histone H4 antibody is a polyclonal antibody that specifically binds to the amino-terminal region of Histone H4. Histones are a group of highly basic and acidic proteins that play a crucial role in DNA packaging and gene regulation. This antibody is widely used in Life Sciences research to study the binding proteins, hormone regulation, and various cellular processes.</p>

<p>CDC6 antibody was raised in Rabbit using Human CDC6 as the immunogen</p>

<p>Inhibin alpha antibody was raised in Mouse using a purified recombinant fragment of human INHA expressed in E. coli as the immunogen.</p>

<p>The Dysferlin antibody is a polyclonal antibody that specifically targets the fibrinogen molecule. It is commonly used in Life Sciences research to study the activation of fibrinogen and its role in various biological processes. This antibody can be utilized in experiments involving electrodes, insulin, and other molecules or drugs. Additionally, it has been shown to have an impact on endogenous hematopoietic cells and endothelial growth factors. The Dysferlin antibody has also demonstrated anticoagulant properties when tested with human serum. Its versatility makes it an essential tool for researchers studying growth factors, fatty acids, and other related areas of study.</p>

<p>CIT antibody was raised in Rabbit using Human CIT as the immunogen</p>

<p>EZH1 antibody was raised in Rabbit using Human EZH1 as the immunogen</p>

<p>CLPB antibody was raised using a synthetic peptide corresponding to a region with amino acids QGGRFDTKCLAAATWGRLPGPEETLPGQDSWNGVPSRAGLGMCALAAALV</p>

<p>Galectin 3 antibody is an essential tool used in Life Sciences research. It is a polyclonal antibody that specifically targets galectin 3, a protein involved in various biological processes. This antibody has been extensively studied and proven to be effective in neutralizing the activity of galectin 3.</p>

<p>ADD1 antibody was raised in Rabbit using Human ADD1 as the immunogen</p>

<p>Purified Rabbit polyclonal OR6J1 antibody</p>

<p>Rabbit polyclonal Histone H2A antibody (Thr121)</p>

<p>Rabbit polyclonal ARF5 antibody</p>

<p>NONO antibody was raised using the N terminal of NONO corresponding to a region with amino acids KQNHTPRKHHQHHHQQQHHQQQQQQPPPPPIPANGQQASSQNEGLTIDLK</p>

<p>FHL2 antibody was raised in Rabbit using Human FHL2 as the immunogen</p>

<p>EFCAB4B antibody was raised in Rabbit using Human EFCAB4B as the immunogen</p>

<p>RNPEPL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKPADIGPRSRVWAEPCLLPTATSKLSGAVEQWLSAAERLYGPYMWGRYD</p>

<p>ADPRHL2 antibody was raised in Rabbit using Human ADPRHL2 as the immunogen</p>

<p>Rabbit polyclonal PSEN1 antibody (Ser357)</p>

<p>Rabbit polyclonal TPM1 antibody (HRP)</p>

<p>GFAP antibody is a highly specific monoclonal antibody used in Life Sciences research. It targets glial fibrillary acidic protein (GFAP), which is an intermediate filament protein found in astrocytes, a type of glial cell in the central nervous system. This antibody recognizes and binds to GFAP, allowing researchers to study the expression and localization of this protein.</p>

<p>Purified Polyclonal PANK2 antibody</p>

<p>Purified Rabbit polyclonal WRKY3.1 antibody</p>

<p>The IPKA antibody is a histidine-rich growth factor that is capable of neutralizing autoantibodies. It belongs to the class of monoclonal antibodies and has shown promising results in various studies. The IPKA antibody has been extensively studied in the field of Life Sciences and has been found to have natriuretic and neuroprotective properties. It works by specifically targeting and binding to specific antigens, leading to an antigen-antibody reaction that helps in the activation of certain biological processes. With its unique properties, the IPKA antibody holds great potential for therapeutic applications in various fields.</p>

<p>DPYS antibody was raised in Rabbit using Human DPYS as the immunogen</p>

<p>AGPAT3 antibody was raised in rabbit using the middle region of AGPAT3 as the immunogen</p>

<p>Rabbit polyclonal Thioredoxin antibody (FITC)</p>

<p>The KLRG1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and inhibit the proteolytic activity of KLRG1, a protein involved in cell cytotoxicity. This antibody specifically binds to KLRG1, preventing its interaction with other proteins and inhibiting its function.</p>

<p>The IL1b antibody is a specific antibody that is commonly used in the field of Life Sciences. This antibody is designed to specifically bind to IL1b, which is a protein involved in immune response and inflammation. The IL1b antibody can be used for various applications, including immobilization on an electrode for detection purposes. It recognizes tyrosine residues on IL1b and can be used to study the activation of this protein. Additionally, the IL1b antibody can be used in research related to cancer treatment, as it has been shown to have antagonist binding properties against oncogenic kinases such as epidermal growth factor receptor (EGFR). Overall, the IL1b antibody is a valuable tool for researchers studying immune response, inflammation, and cancer biology.</p>

<p>GADD45A antibody was raised in Rabbit using Human GADD45A as the immunogen</p>

<p>The Beta-2-microglobulin monoclonal antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody specifically targets and binds to Beta-2-microglobulin, a protein found on the surface of cells. By binding to this protein, the antibody can modulate various cellular processes.</p>

<p>The Rab1A antibody is a highly effective growth factor that is used in the field of Life Sciences. This biochemical compound is available in both monoclonal and polyclonal forms, making it versatile for various applications. The Rab1A antibody works by inhibiting the activity of Rab1A, a protein involved in intracellular trafficking. By blocking this protein, the antibody prevents the transport of molecules within cells, thereby affecting cellular processes such as nuclear signaling and e-cadherin expression. With its high specificity and affinity, this antibody is an essential tool for researchers studying cellular mechanisms and developing new medicaments. Whether you're working on a colloidal microsphere or exploring inhibitors for specific pathways, the Rab1A antibody is an indispensable asset in your scientific arsenal. Trust its exceptional performance to deliver accurate results and advance your research in the field of Life Sciences.</p>

<p>Rabbit polyclonal Claudin 3 antibody (Tyr219)</p>

<p>DDA1 antibody was raised in Rabbit using Human DDA1 as the immunogen</p>

<p>The ROCK1 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to the ROCK1 protein, which plays a crucial role in cell migration, adhesion, and contraction. By inhibiting the activity of ROCK1, this antibody can help researchers study the function of this protein and its involvement in various cellular processes.</p>

<p>Affinity purified Rabbit polyclonal MPP2 antibody</p>

<p>The RAD51A antibody is a highly specialized polyclonal antibody that is commonly used in life sciences research. It is also available as a monoclonal antibody for more specific applications. This antibody plays a crucial role in DNA repair and recombination processes by binding to the RAD51 protein, which is involved in homologous recombination. The RAD51A antibody can be used in various techniques, such as immunofluorescence, immunohistochemistry, and western blotting, to study the expression and localization of RAD51A in different cell types and tissues. It is often conjugated with colloidal gold or fluorescent dyes like fluorescein isothiocyanate (FITC) for easy detection. The RAD51A antibody has high affinity and specificity for its target antigen, allowing for accurate quantitation and neutralizing activity against the RAD51 protein. Researchers rely on this antibody to gain insights into DNA repair mechanisms, cancer biology, and other areas of scientific interest.</p>

<p>The LRG antibody is a polyclonal antibody that specifically targets adeno-associated virus (AAV) in Life Sciences research. It is designed to bind to the cytidine residues on the AAV genome, allowing for efficient detection and analysis of viral particles. The LRG antibody can be used in various applications, including immunofluorescence, western blotting, and ELISA assays. Additionally, this antibody has been conjugated to different nanocomposite materials, such as polymeric micelles, for targeted drug delivery purposes. The LRG antibody is also used in the development of DNA aptamers and insulin antibodies for the treatment of cytotoxic conditions like cancer or autoimmune disorders. With its high specificity and affinity towards AAV, as well as its versatility in various research applications, the LRG antibody is an essential tool for researchers in the field of Life Sciences.</p>

<p>SARS antibody was raised using the middle region of SARS corresponding to a region with amino acids SQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDL</p>

<p>Rabbit polyclonal LPCAT2 antibody</p>

<p>ApoA-V (ab) antibody was raised in Mouse using a purified recombinant fragment of human APOA5 expressed in E. coli as the immunogen.</p>

<p>CACNG4 antibody was raised using the N terminal of CACNG4 corresponding to a region with amino acids GPPPRRARGDLTHSGLWRVCCIEGIYKGHCFRINHFPEDNDYDHDSSEYL</p>

<p>The MMP2 antibody is a highly specialized polyclonal antibody that targets the matrix metalloproteinase 2 (MMP2) protein. This antibody is widely used in life sciences research to study the role of MMP2 in various biological processes. MMP2 is a key enzyme involved in the degradation of extracellular matrix components, and its dysregulation has been implicated in several diseases, including cancer, cardiovascular diseases, and inflammatory disorders.</p>

<p>Purified Polyclonal MRPL15 antibody</p>

<p>Rabbit polyclonal BID antibody (Ser78)</p>

<p>Purified Polyclonal AGBL4 antibody</p>

<p>Rabbit polyclonal MAPKAPK5 antibody</p>

<p>Rabbit polyclonal Rhombotin 1 antibody</p>

BCHE antibody was raised using the N terminal of BCHE corresponding to a region with amino acids SSLHVYDGKFLARVERVIVVSMNYRVGALGFLALPGNPEAPGNMGLFDQQ

<p>The CEA antibody is a monoclonal antibody that targets the carcinoembryonic antigen (CEA), a protein that is overexpressed in certain types of cancer cells. This antibody specifically binds to CEA and can be used for various applications in the field of Life Sciences. It has been widely used in research studies to detect CEA expression in tumor tissues and monitor its levels in patient samples.</p>

<p>HIV1 gp120 antibody (biotin) was raised in rabbit using purified, full length recombinant gp120 (HIV-1) produced in baculovirus expression system as the immunogen.</p>