Primary Antibodies

BOLL antibody was raised using a synthetic peptide corresponding to a region with amino acids GGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVSKGYGFVTFETQEDAQ

The Raf1 antibody is a polyclonal antibody that specifically targets the Raf1 protein. It is commonly used in the field of life sciences for research purposes. The Raf1 protein plays a crucial role in cell signaling pathways, particularly in the regulation of cell growth and differentiation. This antibody can be used to detect and quantify the expression levels of Raf1 in various samples, such as serum or tissue extracts. It is highly specific and sensitive, making it a valuable tool for studying the function and activity of Raf1 in different biological processes. Researchers often rely on this antibody to investigate the involvement of Raf1 in diseases like cancer, cardiovascular disorders, and neurological conditions. Its high affinity for the target antigen ensures accurate and reliable results, making it an essential component in many scientific studies.

CD62L antibody (PE-CY7) was raised in rat using C3H/eb cloned murine B lymphoma 38C-13 as the immunogen.

Rabbit polyclonal TLP5 antibody

Purified Rabbit polyclonal OR7C2 antibody

The HDAC3 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is specifically designed to target and detect HDAC3, a protein involved in various cellular processes. This antibody has been extensively validated and proven to be highly specific and sensitive in detecting HDAC3 levels.

Rabbit polyclonal BRCA1 antibody (Ser1423)

The TIE2 antibody is a highly specialized polyclonal antibody used in the field of Life Sciences. It is specifically designed for research purposes and is widely used in various applications such as immunohistochemistry, Western blotting, and flow cytometry.

MMP9 antibody was raised in mouse using a synthetic peptide corresponding to amino acid 626-644 of human MMP9 as the immunogen.

Rabbit Polyclonal MARK1 antibody (Thr215)

This HRP Conjugated Goat anti-Dog IgE specifically reacts with the IgE heavy chain and not with IgG, IgA, IgM or IgD. It is suitable for use as the detection antibody in various immunoassays.

The ARAF antibody is a peptide receptor that is widely used in Life Sciences. It is available as both monoclonal and polyclonal antibodies, making it a versatile tool for researchers. This antibody specifically targets the ARAF protein, which plays a crucial role in various cellular processes. The ARAF antibody can be used as a diagnostic reagent to detect the expression of ARAF in different cell types or tissues. Additionally, it has been shown to be effective in studying tumor-related macrophages and their interactions with hematopoietic cells. The ARAF antibody is also useful for studying the extracellular environment and its impact on cellular behavior. Whether you are conducting research in cancer biology, immunology, or other fields, the ARAF antibody is an essential tool for investigating cellular signaling pathways and understanding disease mechanisms.

Rabbit polyclonal NFKB p100 antibody

HTR1F antibody was raised in rabbit using the N terminal of HTR1F as the immunogen

Rabbit polyclonal Tuberin antibody (Thr1462)

Rabbit polyclonal GAS41 antibody

FECH antibody was raised using a synthetic peptide corresponding to a region with amino acids LDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGM

Rabbit Polyclonal Myc antibody (Ser62)

Rabbit polyclonal NMDAR2A antibody

CDRT4 antibody was raised using the middle region of CDRT4 corresponding to a region with amino acids TSQTVKRLIEKSKTRELECMRALEERPWASRQNKPSSVIQPKRRKSSKSS

Rabbit polyclonal MED18 antibody

The TBX1 antibody is a highly specialized antibody that plays a crucial role in the field of Life Sciences. It specifically targets and binds to a cell antigen found on functional endothelial cells. This antibody is produced by hybridoma cells and has been extensively studied for its ability to inhibit the growth factor responsible for the development of pluripotent stem cells.

CHAC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TPQNPGYLGPAPEEAIATQILACRGFSGHNLEYLLRLADFMQLCGPQAQD

TNF Receptor 1 antibody is a highly effective monoclonal antibody used in the field of Life Sciences. It is specifically designed to neutralize the activity of TNF receptor 1, a cell surface protein involved in various cellular processes. This antibody acts as a potent inhibitor of TNF receptor 1 signaling, which plays a crucial role in inflammation and immune response. The TNF Receptor 1 antibody has been extensively studied and proven to be effective in inhibiting the growth factor-induced activation of downstream pathways. It has also shown promising results in preclinical studies targeting diseases such as cancer and autoimmune disorders. With its high specificity and cytotoxic properties, this antibody holds great potential for therapeutic applications in targeted therapy. Whether used alone or in combination with other antibodies such as anti-VEGF or tyrosinase inhibitors, TNF Receptor 1 antibody offers a promising avenue for researchers and clinicians alike in their quest to combat various diseases effectively.

Carbonic Anhydrase Vb antibody (Mitochondrial) was raised using the N terminal of CA5B corresponding to a region with amino acids WRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPL

DHX38 antibody was raised in mouse using recombinant Human Deah (Asp-Glu-Ala-His) Box Polypeptide 38 (Dhx38)

The Tetracycline antibody is a highly specific monoclonal antibody that binds to tetracycline, a broad-spectrum antibiotic. This antibody has a high receptor binding affinity and can be used in various applications, such as polymerase chain reactions (PCR), immunohistochemistry, and Western blotting. It specifically targets tetracycline residues in biological samples, allowing for the detection and quantification of this antibiotic. In addition to its use in research, the Tetracycline antibody has potential applications in the field of medicine. It can be used to study the cellular localization of tetracycline within cells or tissues, providing valuable insights into its mechanism of action. Furthermore, this antibody can be utilized to investigate protein-protein interactions involving tetracycline or its derivatives. The Tetracycline antibody is produced using advanced techniques in monoclonal antibody production. It exhibits high specificity and sensitivity, ensuring reliable and accurate results. This antibody is compatible with various sample types, including