Primary Antibodies

<p>The TNFSF11 antibody is a polyclonal antibody commonly used in life sciences research. It is an essential protein reagent that plays a crucial role in various biological processes. This antibody specifically targets the TNFSF11 protein, also known as RANKL (Receptor Activator of Nuclear Factor Kappa-B Ligand).</p>

<p>ABT1 antibody was raised in Rabbit using Human ABT1 as the immunogen</p>

<p>Rabbit polyclonal APC6 antibody</p>

The TUSC2 antibody is a highly versatile product used in the field of Life Sciences. It is derived from recombinant allergens and exhibits strong binding capabilities to specific polypeptide sequences. This antibody has been extensively studied and proven effective in various applications.

<p>Purified Rabbit polyclonal PRKCA antibody</p>

<p>Rabbit polyclonal PNMAL1 antibody</p>

<p>CUTC antibody was raised in Rabbit using Human CUTC as the immunogen</p>

<p>Mouse monoclonal PPWD1 antibody</p>

<p>Purified Polyclonal CK1 delta antibody</p>

<p>The GOLM1 antibody is a specific antibody that targets the Golgi membrane protein 1 (GOLM1). It is a monoclonal antibody that has been developed to detect and bind to GOLM1, which is involved in various cellular processes. This antibody can be used for research purposes, such as studying the function of GOLM1 in different cell types or investigating its role in disease development. The GOLM1 antibody has also shown potential as a serum marker for certain conditions, making it a valuable tool for diagnostic applications. With its high specificity and sensitivity, this antibody offers researchers and clinicians a reliable means of studying and detecting GOLM1 in various biological samples.</p>

<p>The TRPC6 antibody is a growth factor-neutralizing monoclonal antibody that specifically targets the alpha-fetoprotein (AFP) protein complex. This antibody is designed to bind to and neutralize the activity of AFP, which plays a crucial role in promoting cell growth and proliferation. By blocking AFP, the TRPC6 antibody inhibits the signaling pathways that contribute to tumor development and progression.</p>

<p>Affinity purified Rabbit polyclonal NOXO1 antibody</p>

<p>Shigella Boydii Monoclonal Antibody</p>

<p>CYC1 antibody was raised in Rabbit using Human CYC1 as the immunogen</p>

<p>AGGF1 antibody was raised in Rabbit using Human AGGF1 as the immunogen</p>

<p>The PLOD2 antibody is a highly specialized product in the field of Life Sciences. It is used to detect and study the expression of PLOD2, an enzyme involved in collagen synthesis. This colloidal antibody is designed to specifically recognize and bind to PLOD2, allowing for accurate detection and analysis in various research applications.</p>

<p>Rabbit polyclonal HRNPK antibody (Ser216)</p>

<p>Affinity purified Rabbit polyclonal beta-Gal antibody</p>

<p>SKIV2L antibody was raised using a synthetic peptide corresponding to a region with amino acids SSNSTSRVFTTLVLCDKPLSQDPQDRGPATAEVPYPDDLVGFKLFLPEGP</p>

<p>Rat monoclonal CD31 antibody (allophycocyanin)</p>

<p>GAD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MASSTPSSSATSSNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGF</p>

<p>Rabbit polyclonal BRCA1 antibody (FITC)</p>

<p>AVPI1 antibody was raised in Rabbit using Human AVPI1 as the immunogen</p>

<p>The P-Selectin antibody is an amide-based monoclonal antibody that specifically targets the glycoprotein P-Selectin. This medicament is widely used in the field of Life Sciences for various biochemical studies and research purposes. The P-Selectin antibody can be utilized in experiments involving microspheres, as well as for the detection and analysis of activated cells expressing P-Selectin. Additionally, this antibody has shown affinity towards other proteins such as E-Cadherin, making it a versatile tool for studying cell adhesion and signaling pathways. With its high specificity and sensitivity, the P-Selectin antibody is a valuable asset in the field of immunology and molecular biology research.</p>

<p>Rabbit polyclonal UBE2Z antibody</p>

<p>Rabbit polyclonal Galectin 7 antibody (HRP)</p>

<p>Mouse monoclonal IL36A antibody</p>

<p>Purified Polyclonal RANBP6 antibody</p>

<p>Rabbit polyclonal OR5K1 antibody</p>

<p>Rabbit polyclonal FKBP1A antibody (HRP)</p>

<p>Goat anti-syrian hamster IgG (H + L) (HRP) was raised in goat using hamster IgG (H &amp; L) as the immunogen.</p>

<p>DLGAP5 antibody was raised in Rabbit using Human DLGAP5 as the immunogen</p>

<p>Rabbit polyclonal Cathepsin F antibody (FITC)</p>

<p>Factor XIII Subunit A antibody (HRP) was raised in sheep using human Factor XIII Subunit A (A2) purified from plasma as the immunogen.</p>

<p>ANXA2 antibody was raised in Rabbit using Human ANXA2 as the immunogen</p>

<p>FADS1 antibody was raised in Rabbit using Human FADS1 as the immunogen</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that belongs to the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds with bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. It has been extensively studied using advanced techniques like transcription-quantitative polymerase chain reaction and patch-clamp technique. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>GATA1 antibody was raised in Mouse using a purified recombinant fragment of human GATA1 expressed in E. coli as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, thus inhibiting bacterial growth and preventing transcription and replication. With its patch-clamp technique, it has been proven to have a high frequency of human activity. The metabolization process involves various transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, leading to inhibited cell growth in culture.</p>

<p>Rabbit polyclonal Merlin antibody (Ser518)</p>

<p>Mouse monoclonal Staphylococcus Enterotoxin B antibody</p>

<p>RELT antibody is a monoclonal antibody that specifically targets ferritin, a protein involved in iron homeostasis. This antibody has been shown to inhibit oxidative damage caused by ferritin and prevent the accumulation of iron in cells. In addition, RELT antibody has shown potential therapeutic effects against various diseases, including influenza hemagglutinin and fibrinogen-related disorders. It has also been found to inhibit the growth of hepatocyte growth factor-dependent tumors. This monoclonal antibody derivative works by binding to specific epitopes on ferritin and blocking its activity. By targeting ferritin at the molecular level, RELT antibody offers a promising approach for the development of targeted therapies in Life Sciences.</p>

<p>Affinity purified Rabbit polyclonal GCLC antibody</p>

<p>Rabbit polyclonal GABRG2 antibody</p>

<p>Rabbit polyclonal TMX4 antibody</p>

<p>PNMA1 antibody was raised using the middle region of PNMA1 corresponding to a region with amino acids LNTYQNPGEKLSAYVIRLEPLLQKVVEKGAIDKDNVNQARLEQVIAGANH</p>

<p>Rabbit polyclonal HDAC9 antibody</p>

<p>Rabbit polyclonal MRPL51 antibody</p>

<p>The ALMS1 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the ALMS1 protein, which is an oncogene homolog. The antibody has been extensively tested and validated for its specificity and sensitivity. It can be used in various applications such as Western blotting, immunohistochemistry, and ELISA.</p>

<p>Affinity purified Rabbit polyclonal GYG2 antibody</p>

<p>CSF1 antibody was raised in Mouse using a purified recombinant fragment of human CSF1 expressed in E. coli as the immunogen.</p>

<p>Histone H4 antibody is a polyunsaturated antibody that specifically targets the histone H4 protein. This antibody has been shown to neutralize the activity of arachidonic acid, a key molecule involved in various biological processes. By blocking the action of arachidonic acid, this antibody can inhibit the angiogenic response and reduce inflammation. It has also been used in Life Sciences research to study the effects of chemical inhibitors on erythropoietin and other angiogenesis-related proteins. Additionally, this monoclonal antibody has been utilized to investigate the role of histone H4 in arachidonic acid metabolism and its impact on cellular processes. With its high specificity and ability to target activated histone H4 residues, this antibody is an essential tool for studying the intricate mechanisms of arachidonic acid signaling pathways and their involvement in various physiological and pathological conditions.</p>

<p>The MCL1 antibody is a monoclonal antibody used in clinical settings for immunohistochemistry. It specifically targets the protein kinase CYP2A6 and is commonly used in Life Sciences research. This antibody plays a crucial role in the detection and analysis of MCL1 protein expression, making it a valuable tool in various scientific studies. Additionally, the MCL1 antibody has potential therapeutic applications as an effective medicament against certain diseases. Its high specificity and sensitivity make it a reliable choice for immunohistochemical detection, providing accurate and reliable results. Whether used in research or clinical settings, this monoclonal antibody offers great potential for advancing scientific understanding and improving patient care.</p>

<p>Rabbit polyclonal L2HGDH antibody</p>

<p>The UCHL1 antibody is a powerful tool used in Life Sciences research. It is available in both polyclonal and monoclonal forms, providing researchers with options for their specific needs. This antibody targets UCHL1, a growth factor that plays a crucial role in various biological processes.</p>

<p>The CRP antibody is a highly effective growth factor that activates insulin and is commonly used in the field of Life Sciences. This monoclonal antibody has been specifically designed to target and neutralize phosphatase, which plays a crucial role in various biological processes. The CRP antibody is produced using advanced colloidal techniques, ensuring high purity and potency.</p>

<p>TNFC antibody is a powerful tool used in Life Sciences research for studying the role of tumor necrosis factor (TNF) in various biological processes. This polyclonal antibody specifically targets TNF and can be used to detect and quantify its presence in samples. TNFC antibody binds to TNF, preventing its interaction with its receptors and inhibiting downstream signaling pathways. It has been extensively used to study the effects of TNF on epidermal growth factor signaling, insulin sensitivity, lipoprotein lipase activity, and glutamate release in mesenchymal stem cells. Additionally, TNFC antibody has been employed in autoimmune disease research to investigate the presence of autoantibodies against TNF or its receptors. Researchers also use monoclonal antibodies such as anti-HER2 antibody or trastuzumab alongside TNFC antibody to study complex protein interactions and signaling pathways involving TNF. With its high specificity and sensitivity, TNFC antibody is an invaluable tool for understanding the role of TNF</p>

<p>The Claudin 1 antibody is an acidic monoclonal antibody that specifically targets the claudin 1 protein. It is commonly used in Life Sciences research to study the role of claudin 1 in various cellular processes. This antibody has been shown to have neutralizing effects on claudin 1, which plays a crucial role in cell adhesion and tight junction formation. By blocking the function of claudin 1, this antibody can inhibit the growth and migration of cells. Additionally, it has been found to have neurotrophic properties and can promote the survival and differentiation of neurons. The Claudin 1 antibody is a valuable tool for researchers studying cell biology, cancer biology, and neurobiology.</p>

<p>The FGFR4 Antibody is a powerful inhibitor that targets the protein kinase activity of fibroblast growth factor receptor 4 (FGFR4). This monoclonal antibody specifically binds to FGFR4, blocking its activation and preventing downstream signaling pathways. It has been shown to have high affinity for human serum albumin, making it suitable for use in various research applications.</p>

<p>Mouse monoclonal IL1 beta antibody (biotin)</p>

<p>Mouse monoclonal SLC7A8 antibody</p>

<p>PKC gamma antibody is a monoclonal antibody that specifically targets and inhibits the activity of protein kinase C gamma (PKC gamma). It is designed to selectively bind to PKC gamma, preventing its activation and downstream signaling pathways. This antibody utilizes a biocompatible polymer linker group with a disulfide bond for stability and cytotoxicity.</p>

<p>The SHH antibody is a monoclonal antibody that specifically targets the Sonic Hedgehog (SHH) protein. It is used in Life Sciences research to study the function and regulation of SHH signaling pathway. The SHH protein plays a crucial role in embryonic development, cell differentiation, and tissue regeneration. This antibody can be used for various applications such as Western blotting, immunohistochemistry, and flow cytometry to detect and quantify the expression of SHH protein in different biological samples. Additionally, the SHH antibody has been shown to have potential therapeutic applications in diseases related to abnormal SHH signaling, including certain types of cancer and developmental disorders. With its high specificity and sensitivity, this antibody is a valuable tool for researchers studying SHH-related pathways and exploring new therapeutic strategies.</p>

<p>PRPF4 antibody was raised using a synthetic peptide corresponding to a region with amino acids EVFEIEEHISERQAEVLAEFERRKRARQINVSTDDSEVKACLRALGEPIT</p>

ELOF1 antibody was raised in rabbit using the middle region of ELOF1 as the immunogen

<p>CHCHD1 antibody was raised using the middle region of CHCHD1 corresponding to a region with amino acids KEIQGFLDCAARAQEARKMRSIQETLGESGSLLPNKLNKLLQRFPNKPYL</p>

<p>Rabbit polyclonal CYP26A1 antibody</p>

<p>Rabbit polyclonal SLP76 antibody (Tyr128)</p>

<p>HNRPUL1 antibody was raised using the C terminal of HNRPUL1 corresponding to a region with amino acids TYPQPSYNQYQQYAQQWNQYYQNQGQWPPYYGNYDYGSYSGNTQGGTSTQ</p>

<p>Rabbit Polyclonal ENAC beta antibody</p>

<p>Fibrinopeptide A antibody (HRP) was raised in sheep using Synthetic Fibrinopeptide A 1-16 conjugated to carrier as the immunogen.</p>

<p>Mouse monoclonal KLHL2 antibody</p>

<p>Rabbit polyclonal RPS4Y1 antibody</p>

<p>Purified Polyclonal RAD23B antibody</p>

<p>Rabbit polyclonal OR5D13 antibody</p>

<p>Nucleobindin 2 antibody was raised using the middle region of NUCB2 corresponding to a region with amino acids MMKEHERREYLKTLNEEKRKEEESKFEEMKKKHENHPKVNHPGSKDQLKE</p>

<p>DSG2 antibody was raised in Rabbit using Human DSG2 as the immunogen</p>

Vitronectin antibody (HRP) was raised in sheep using human Vitronectin purified from plasma as the immunogen.

<p>ENPEP antibody was raised in Rabbit using Human ENPEP as the immunogen</p>

<p>The NF kappaB p65 antibody is a glycoprotein that plays a crucial role in various cellular processes, including the regulation of immune responses and inflammation. It is a mitogen-activated protein that acts as a transcription factor and controls the expression of genes involved in cell survival, proliferation, and differentiation.</p>

<p>FADS1 antibody was raised using the C terminal of FADS1 corresponding to a region with amino acids FNDWFSGHLNFQIEHHLFPTMPRHNYHKVAPLVQSLCAKHGIEYQSKPLL</p>

<p>ITLN2 antibody was raised using the middle region of ITLN2 corresponding to a region with amino acids TVGDRWSSQQGNKADYPEGDGNWANYNTFGSAEAATSDDYKNPGYYDIQA</p>

<p>The CNTF antibody is a polyclonal antibody used in Life Sciences research. It is designed to specifically target and bind to CNTF (Ciliary Neurotrophic Factor), a protein involved in neural development and survival. This antibody can be used for various applications, including immunohistochemistry, western blotting, and ELISA.</p>

<p>The NOTCH2 antibody is a powerful tool used in life sciences research. It is an electrode that specifically targets the circumsporozoite protein, neutralizing its activity. This antibody has been shown to have a high affinity for acidic environments and effectively binds to tyrosine residues on the target protein.</p>

<p>Rabbit Polyclonal IGF1R antibody (Tyr1280)</p>

<p>RALY antibody was raised using the middle region of RALY corresponding to a region with amino acids TQIKSNIDALLSRLEQIAAEQKANPDGKKKGDGGGAGGGGGGGGSGGGGS</p>

<p>Mouse monoclonal GSTO2 antibody</p>

<p>The PKC gamma antibody is a highly effective neutralizing monoclonal antibody that targets the protein kinase C gamma (PKCγ). This antibody acts as a potent family kinase inhibitor, blocking the activity of PKCγ and preventing its role in cell signaling pathways. By inhibiting PKCγ, this antibody has been shown to have anti-VEGF (vascular endothelial growth factor) activity, which can help inhibit the growth of blood vessels and limit angiogenesis. Additionally, it can bind to alpha-fetoprotein (AFP), a tumor marker expressed in certain cancers, and neutralize its effects.</p>

<p>MTRR antibody was raised using the N terminal of MTRR corresponding to a region with amino acids YDLKTETAPLVVVVSTTGTGDPPDTARKFVKEIQNQTLPVDFFAHLRYGL</p>

<p>KIF22 antibody was raised in Rabbit using Human KIF22 as the immunogen</p>

<p>Rabbit polyclonal PLAU antibody (biotin)</p>

<p>SDCCAG8 antibody was raised using the middle region of SDCCAG8 corresponding to a region with amino acids IQCDQLRKELERQAERLEKELASQQEKRAIEKDMMKKEITKEREYMGSKM</p>

<p>Rabbit polyclonal PSMD3 antibody</p>

<p>Affinity purified Rabbit polyclonal OLIG1 antibody</p>

<p>LRP antibody (85 kDa) was raised in mouse using human LRP/a2MR as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, which inhibits bacterial growth and prevents transcription and replication. Its effectiveness has been proven through extensive research using the patch-clamp technique on human erythrocytes.</p>

<p>SNRPF antibody was raised using the N terminal of SNRPF corresponding to a region with amino acids MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEY</p>

<p>Rabbit polyclonal P4HA2 antibody</p>

<p>Complement C3a alpha antibody was raised in mouse using human complement component C3 as the immunogen.</p>

<p>Affinity purified Rabbit polyclonal CDC25B antibody</p>